KEGG   Bos indicus (zebu cattle): 109566517
Entry
109566517         CDS       T04792                                 

Gene name
SPTAN1
Definition
(RefSeq) spectrin alpha chain, non-erythrocytic 1 isoform X1
  KO
K06114  spectrin alpha
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109566517 (SPTAN1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:biu04812]
    109566517 (SPTAN1)
Cytoskeleton proteins [BR:biu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     109566517 (SPTAN1)
  Intermediate filaments
   Intermediate filament-binding proteins
    109566517 (SPTAN1)
SSDB
Motif
Pfam: Spectrin EFhand_Ca_insen SH3_1 EF-hand_1 EF-hand_7 SH3_9 EF-hand_6 EF-hand_8 EF-hand_5 SH3_2 SH3_3 SH3_10 SCO1-SenC
Other DBs
NCBI-GeneID: 109566517
NCBI-ProteinID: XP_019826517
Position
11
AA seq 2489 aa
MLSSFRKRRVQKMDPSGVKVLETAEDIQERRQQVLDXYHRFKELSTLRRQKLEDSYRFQF
FQRDAEELEKWIQEKLQIASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIVKLDETGNL
MISEGHFASETIRTRLMELHRQWELLLEKMREKGIKLLQAQKLVQYLRECEDVMDWINDK
EAIVTSEELGQDLEHVEVLQKKFEEFQTDMAAHEERVNEVNQFAAKLIQEQHPEEELIKT
KQDEVNAAWQRLKGLALQRQGKLFGAAEVQRFNRDVDETISWIKEKEQLMASDDFGRDLA
SVQALLRKHEGLERDLAALEDKVKALCAEADRLQQSHPLSATQIQVKREELITNWEQIRT
LAAERHARLNDSYRLQRFLADFRDLTSWVTEMKALINADXLANDVAGAEALLDRHQEHKG
EIDAHEDSFKSADESGQALLAAGHYASDEVREKLTVLSEERAALLELWELRRQQYEQCMD
LQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDE
FATKLIQNNHYAMEDVATRRDALLSRRNALHERAMYRRAQLADSFHLQQFFRDSDELKSW
VNEKMKTATDEAYKDPSNLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVDHYAKDE
VAARMNEVISLWKKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGK
DLTNVQNLQKKHALLEADVAAHQDRIDGITIQARQFQDAGHFDAENIKKKQEALVARYEA
LKEPMVARKQKLADSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQA
LQAEIAGHEPRIKAVTQKGNAMVEEGHFAAEDVKAKLHELNQKWESLKSKASQRRQDLED
SLQAQQYFADANEAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSSIQA
LREQAQSCRQQVAPMDDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVE
VNDRQGFVPAAYVKKLDPAQSASRENLLEEQGSIALRQEQIDNQTRVTKEAGSVSLRMKQ
VEELYHSLLELGEKRKGMLEKSCKKFMLFREANELQQWINEKEAALTSEEVGADLEQVEV
LQKKFDDFQKDLKANESRLKDINKVAEDLESEGLMAEEVQAVQQQEVYGXMPRDESDSKT
ASPWKSARLMVHTVATFNSIKELNERWRSLQQLAEERSQLLGSAHEVQRFHRDADETKEW
IEEKNQALNTDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAERLIQSHPESAE
DLQEKCTELNQAWSSLGKRADQRKAKLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELA
KDVTGAEALLERHQEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEIKEKLDVLDQERA
DLEKAWVQRRMMLDQCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHE
DFDKAINVQEEKIAALQSFADQLIAGGHYAKGDISSRRNEVLDRWRRLKAQMIEKRSKLG
ESQTLQQFSRDVDEIEAWISEKLQTASDESYKDPTNIQLSKLLSKHQKHQAFEAELHANA
DRIRGVIDMGNSLIDRGACAGSEDAVKARLAALADQWQFLVQKSAEKSQKLKEANKQQNF
NTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNSQADS
LMTSSAFDTSQVKDKRDAINGRFQKIKSMAASRRARLNESHRLHQFFRDMDDEESWIKEK
KLLVSSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTIGKEEIQQ
RLAQFVEHWKELKQLAAARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLA
AIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLVKKNNHHEENISSKMKGLNGKVSDLEK
AASQRKAKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDA
GLQAFQQEGIANITALKDQLLAAKHVQSKAIEARHAALMKRWSQLLANSATRKKKLLEAQ
SHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSA
QADFNQLAELDRQIKSFRVASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEEN
DKLRQEFAQHANAFHQWIQETRTYLLDGSCMVEESGTLESQLEATKRKHQEIRAMRSQLK
KIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEE
ALKEFSMMFKHFDKDKSGRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFEAILDTVDPNRD
GHVSLQEYMAFMISRETENVKSSEEIESAFRALSSEGKPYVTKEELYQNLTREQADYCVS
HMKPYVDXKGRELPTAFDYVEFTRSLFVN
NT seq 7470 nt   +upstreamnt  +downstreamnt
atgctgtcatcgtttcgtaaacgcagagtccagaaaatggacccaagcggggtcaaagtg
ctggagacagcagaggacatccaggagaggcggcagcaggtcctggacrgataccaccgc
ttcaaggagctctcgaccctgaggcgccagaagcttgaagactcctaccgattccagttt
ttccaaagagatgctgaggagctggagaaatggattcaggagaagcttcagattgcctca
gatgagaattacaaagacccaaccaacctgcagggcaagctgcagaagcatcaagccttc
gaagccgaggtgcaggccaactcgggcgccatcgtgaagctggatgagactggtaacctg
atgatctcagaagggcacttcgcatccgaaaccatccggactcgtctgatggagctgcac
cgccagtgggaattgctcctggagaagatgcgggagaaaggcatcaagctgctgcaggcc
cagaagctggtgcagtacctgcgggagtgtgaggatgtgatggactggatcaatgacaag
gaagccattgtgacgtctgaggagctgggccaggacctggagcacgtggaggtgttacag
aagaaattcgaagagtttcagacagacatggctgcccaygaagagagagtcaatgaagtg
aaccagttcgctgccaagctcattcaggagcagcaccctgaggaggagctgatcaagaca
aagcaggacgaggtgaatgcagcctggcagcggctgaagggcctggccctccagcggcag
gggaagctgttcggggcagctgaggtccaacgctttaacagggatgtggacgagaccatc
agctggattaaggagaaggaacagttaatggcctctgatgactttggccgggacctggcc
agcgtccaggctttactacggaaacacgagggtttggagagagatcttgctgccttggag
gacaaggtcaaagccctgtgtgccgaggctgaccgcctgcagcagtcccaccctctgagt
gccacccagatccaggtgaagcgagaggagctgatcaccaactgggagcagatccgcacc
ctggccgcggagagacacgcacgtctcaacgattcctacaggcttcagcgcttccttgcc
gacttccgagacctcaccagctgggtcactgagatgaaagccctcatcaacgcagatgra
cttgccaacgatgtggccggagccgaagccctgctggataggcatcaggagcacaagggt
gaaattgacgctcatgaagatagctttaaatctgcagatgagtctggacaggccctgctt
gcagctggtcactacgcctcagatgaagtgagggagaagcttaccgtgctgtccgaggag
cgggccgcgctgctggagctctgggagctgcgacggcagcaatatgagcagtgcatggac
ctgcagctcttctaccgcgacacggagcaggtggacaactggatgagcaagcaggaggcg
ttcctgttgaacgaagacctgggcgattccttggatagtgtggaagcgcttctaaagaag
cacgaagactttgagaagtccctcagcgcccaggaggagaagatcacagccttagatgag
tttgccaccaagctgattcagaacaaccactacgcgatggaagatgtggccacccggcga
gacgcactgctgagccgtcgcaatgccctgcatgagagagccatgtaccgccgtgcccag
cttgcagattccttccacttgcagcagtttttccgtgactctgatgagctcaagagttgg
gtcaacgagaagatgaaaacagccacggatgaagcttataaagacccatccaacctacaa
gggaaagtgcagaagcaccaggcctttgaggccgagctctcggcaaaccagagccgcatc
gacgccctggagaaagccgggcagaagctgatcgatgtcgaccactatgccaaggacgag
gtggcggctcggatgaatgaggtcatcagtctgtggaagaagctgctggaggccacagag
ctgaaaggcataaagctccgcgaggctaaccagcagcagcagtttaatcgcaacgttgag
gacatcgagctgtggctgtatgaagtggaaggtcatctggcctcggacgactacggcaaa
gacctcaccaacgtccagaacctccagaagaagcacgccctgctggaggctgacgtggca
gctcaccaggatcgcatcgatggcatcactatccaagcccgccagttccaggacgcgggc
cactttgatgctgaaaacatcaagaagaagcaggaggccctggtagctcgctacgaggcg
ctcaaggagcccatggttgcccggaagcagaagctggctgattccctgcggttgcagcag
ctcttccgtgacgtcgaggatgaggagacgtggattcgggagaaagaacccattgccgcc
tccaccaacagaggcaaagatttaattggagtccagaacctgctaaagaaacaccaagcg
ctacaagcagaaattgctggccacgagccccgcatcaaagcagtcacacagaaggggaac
gccatggtggaggagggccattttgctgctgaggacgtgaaggccaagctccatgagctg
aaccagaagtgggagtcgctgaagtccaaggcctcccagcggcggcaggacctggaggac
tcgctgcaggcccagcagtactttgcygacgccaacgaggctgagtcctggatgcgggag
aaggagcccatcgtgggcagcaccgactatggcaaagatgaggactcggccgaggctctg
ctaaagaagcacgaggcattgatgtcggatctcagcgcctatggcagcagcatccaggcc
ctgcgagagcaggcccagtcgtgccggcaacaagtggcccccatggatgatgagactggg
aaggagctggtcttggcgctctatgactatcaggagaagagtccccgagaggtcaccatg
aagaaaggagacattctcaccttactcaacagcaccaacaaggactggtggaaagtggaa
gtgaatgaccggcagggcttcgtgccggctgcctacgtgaagaagctggatcctgcgcag
tcggcctcccgggagaacctcctggaagagcagggcagcatcgcgctgcggcaggaacag
atcgacaaccagacgcgcgtaactaaggaggctggcagcgtgtctctgcgtatgaaacag
gtggaagaactgtaccattctctgctggaactgggagagaagcgtaaaggcatgttggag
aagagctgtaagaagttcatgttgttccgtgaagcgaacgagctacagcagtggatcaat
gagaaagaagcggccctgacaagtgaggaggttggcgcggacttggagcaggttgaagtg
ctgcagaagaagtttgacgayttccagaaggatctcaaggccaatgagtcgcggctgaag
gacattaacaaggtggctgaagacctggagtcggaaggtctgatggcggaggaggtgcag
gccgtgcagcagcaggaggtgtatggcgygatgcccagggatgaatctgattccaagaca
gcctccccttggaagtctgctcgcctgatggttcacaccgtggccacctttaattccatc
aaggagctgaacgagcgctggcggtccctgcagcagctggctgaggagcggagccaactc
ttgggcagtgcccatgaagtgcagcggttccacagagatgctgacgaaaccaaagagtgg
atcgaagagaagaaccaggctctaaacacagacaactacggccacgacctggccagtgtc
caggccctgcagcgcaagcacgagggcttcgagagggacctcgcagcccttggtgacaag
gtgaactcgctcggggagacagccgagcgcctgatccagtcccaccccgagtcggcagag
gacctgcaggagaagtgcactgagctgaaccaggcatggagcagcctgggcaagcgtgcc
gaccagcgcaaggccaagctgggcgactcccaygacctgcagcgcttcctcagcgacttc
cgggacctcatgtcttggatcaatggaatccgaggtctggtgtcctcagacgagctagcc
aaggatgtcaccggagctgaggccctgctggagcgacaccaggaacaccggacagaaatt
gatgccagagctggcactttccaggcattygagcagtttgggcagcagctgttggctcat
gggcactacgccagccccgagatcaaggagaagctcgatgttctagaccaggagcgtgca
gaccttgagaaggcctgggtccagcgcaggatgatgctggatcagtgccttgaattgcag
ctgttccatcgggattgcgagcaggccgagaactggatggctgcccgagaggcctttctg
aacacagaagacaaaggggactcrctagacagtgtggaggctctgatcaaaaaacacgag
gactttgataaagcaattaatgtccaggaggagaagattgctgccctgcagtcctttgct
gaccagctcatcgctggtggccactacgccaaaggcgacatctccagccggcgcaatgag
gttctggacaggtggcgccgtctaaaagctcagatgattgagaagaggtcaaagctggga
gaatcacagaccctccagcagttcagccgggatgtagacgagattgaagcttggatcagt
gaaaaattacagactgcaagtgatgagtcatataaggaccccaccaacatccagctttcc
aagctgctgagcaagcatcagaagcaccaggccttcgaggcagaactgcacgccaatgcg
gaccggatccgcggggtcatcgacatgggcaactccctcattgaccgcggggcctgcgcc
ggcagcgaggatgccgtcaaggcccggctggccgccttagctgaccagtggcagttcctg
gtgcagaagtcggctgagaagagccagaagctgaaagaagccaacaagcagcagaacttc
aacactggcatcaaggacttcgacttctggctctctgaggtggaagccctgctggcctct
gaggattatggcaaagacctggcttctgtgaacaacttgctaaaaaaacatcagctgctg
gaggcagatatctctgcccacgaggaccgcctgaaggacctcaacagccaggcggacagc
ctgatgaccagcagcgccttcgacacctcccaggtgaaggacaagcgggacgccatcaac
ggccgtttccagaagatcaagagcatggccgcctcgcggcgagctaggctgaatgagtcc
caccgcctgcaccagtttttccgggacatggatgatgaggagtcctggatcaaggaaaag
aagctgctggtgagctcagaggactacggccgtgacctgacgggcgtccagaacctgagg
aagaagcacaaacggctggaagcagagctggctgcccacgagccggccattcagggtgtc
ctggacactggaaagaagctgtctgatgacaacaccatcgggaaggaggagattcagcag
cgcctggcgcagttcgtggagcactggaaggagctgaagcagctggcagctgcccggggc
cagcggctagaagaatctttggaatatcagcagtttgtagccaacgtggaggaggaggaa
gcctggatcaatgagaagatgaccctggtggccagtgaagattatggagacactcttgct
gccatccagggcttgctgaagaaacacgaagccttcgagacggacttcactgtccacaag
gaccgagtgaatgaygtctgcaccaacggccaggacctggttaagaagaacaatcaccat
gaggagaacatctcttccaagatgaagggcttgaacgggaaagtgtcagacttggagaag
gctgcctcccagaggaaggccaagctcgacgagaactcggccttcctccagttcaactgg
aaagccgatgtggtggagtcctggatcggtgaaaaggagaacagcttgaagacagatgat
tatggtcgagatctgtcttctgtccaaactctcctcaccaaacaggaaaccttcgatgct
ggcctgcaggccttccagcaggagggcatcgccaacatcactgccctcaaagatcagctg
ctggccgccaagcacgttcagtccaaggccatcgaggcccgccatgctgccctcatgaag
aggtggagccagctcctggccaactcggccacccggaagaagaagctgctggaggcacag
agtcacttccgcaaggtggaggatctcttcctgacctttgccaaaaaggcttcagccttc
aacagctggtttgaaaacgcagaggaggacttaaccgacccggtgcgctgcaactctctg
gaagagatcaaggccttgagagaggcccacgacgccttccgctcctcgttgagctcggcc
caggccgacttcaaccagctggctgagctggaccgccagatcaagagcttccgcgtggcc
tccaacccctacacctggttcaccatggaggccctggaggagacctggagaaacctacag
aagatcatcaaggaaagggagctggagctgcagaaggagcagcgacggcaggaggagaat
gacaagctgcgccaggagttcgcccagcatgccaacgccttccaccagtggatccaggag
accagaacgtacctcctcgatgggtcctgcatggtggaagaatccgggaccctcgaatca
cagcttgaagctaccaaacgcaaacaccaggagattcgagctatgagaagtcagctcaag
aagattgaagacctgggggcggccatggaggaagcgctgatcctggacaacaagtacacg
gagcacagcaccgtgggcctggcccagcagtgggaccagctcgaccagttgggcatgcgc
atgcagcacaacctggagcagcagatccaggccaggaacacgaccggagtgaccgaggag
gccctcaaagaattcagcatgatgttcaaacacttcgacaaggacaagtcyggccggctg
aaccaccaggagttcaaatcctgtctgcgctccctgggctatgacctgcccatggtggag
gaaggggagcccgaccctgagttcgaggccatcctggacactgtggatcctaacagggac
ggccacgtctccctgcaagagtacatggcctttatgatcagccgtgagaccgagaaygtc
aagtccagcgaggagattgagagcgccttccgggccctgagctctgaagggaagccttat
gtgaccaaggaggagctgtaccagaacctgactcgggaacaagccgactactgcgtctcc
cacatgaagccctacgtggacrgcaagggccgcgaactccccactgcttttgactacgtc
gagttcacccgctcgctcttcgtgaactga

KEGG   Bos indicus (zebu cattle): 109578943
Entry
109578943         CDS       T04792                                 

Gene name
SPTA1
Definition
(RefSeq) spectrin alpha chain, erythrocytic 1
  KO
K06114  spectrin alpha
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109578943 (SPTA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:biu04812]
    109578943 (SPTA1)
Cytoskeleton proteins [BR:biu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     109578943 (SPTA1)
  Intermediate filaments
   Intermediate filament-binding proteins
    109578943 (SPTA1)
SSDB
Motif
Pfam: Spectrin EFhand_Ca_insen SH3_1 SH3_9 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_7 SH3_2 SH3_10 Lipl32
Other DBs
NCBI-GeneID: 109578943
NCBI-ProteinID: XP_019843976
Position
3
AA seq 2408 aa
MESDGSEVLETAEEIQERRQEVLSRYQRFKERVAERGQKLEDSYHYRVFLRDVDDHEKWI
MEKIKTASDKSYEDPTNIQGKYQKHAXFEAEVQAKSRVLPDLEXTRETRFPEGHFAHEDT
KGHLEELNRLWDLLLELTQEKGALLLRALELQQYFQKCADILEWIGDKDALVTSXELGED
WERTEVLHKKFEEFQADMGVRKERVNEVNQYANXCAEEKHPELPSIESKQKEVNAAWERL
HGLALQRQKMLSSAADLQKFKRDVTEAIQWIKEKEAQVTSEDYGKDLVSSEALFHSHKTL
ERSLAVMNDKVKELCSKADKLKLSHPSDAAEIQQMKEDLVSNWERIRNLATSRYEKLQAS
YGYQRFLSDYDELSGWMEEKTALINADELPIDVAGGEALLDRHQQHKHEIDSYDDRFQSA
NETGQTLLDANHEASDEVLKKMSLLTYNWAALLELWEKRRQQYEQCLNLHLFYRDSEQVD
SWMSRQEAFLENEDLGNSLGSVEALRQKHDDFEEAFTAQEEKITTIDKTATKLIDDKHYD
SEKIAAIRDELLVRRDNLRKRAAIRRGLLEDSFLLQQLYQDSDDLKNWINKKKKLADDED
YKETLNLKSQVQKQKVFEEELAANQIRLNNIQKTGQEMIDSNHYASDKVADRLREVESLW
IELQKATEQKGIQLHEANKQLQFENNAEDLMQWLEEVEWQARSQDYGKGLADVQNLLRKH
GLLESAVATRQDQVDTLTDLATYFEEISHPDAGNIRERQEYLVSQFEALKERLAYRKNKL
IDLFHLYQIQRDTEDEEAWIQETEPSVASTYLGKDLITSKNLLNRHHVIQANIASHEPHI
QMITEKGNKMIEEGHFAAEDVASRVNSLNENMESLQARATRRQNDLEANVQFQQYLVDLH
EAEAWIREKEPIVDNTNYGADEEAAGALLKKHEAFLVDLKAFGNSMQALRDQAEACQEQQ
AAPVEVAAPEERVVALYDFEALCSREVTMKKDDVLTLLSSISKDWWKVETDDHQGFVPAV
YVRKLARDEFPMLPQRKREEPGNIIQRQEQIENQYHSLLHRADERRRXLLQRYNEFLLAY
EAGDMLDWIREKKAENTGVELDDVWELQKKFDEFQMDLKANEPRLRDINKVADDLQFEEL
LTPEGAQIQQELNARWRSLQRLAEEQRQLLGSAHAVQMFHREADDTKEQIEKKCQALNTA
DPGSDLFSVQALQRQHENFERDLVPLGEKVEVLRDTADRLSESHPDATDDLQSQQLKLKE
AWDDLQGLTKDRKENLQEALKFYQFLSQARDLQNWISGIGGMVSSQELAEDLTGTEIMIE
RHQEHRADMEAQAPAFQAFEDFGTDLTISGHRASPEIEEKLQAVRLERDELESAWEQRKK
MLDQCLELQLFRGNCDQAESWMVARENDLRSDDKGSLDTLEALMKKRDDLDKAITDQDNR
IAELDLFAERLISEDHYAKEEIAARNQRILDRWRILKEQLTAERMKLGDYADLKQFYHDF
KDQEEWISEMLPIACDESYKDPTNIQRKYLKHKAFEDEVNSRAEQVEGVIILGNTLVERR
ACDGNEESVKDQVEELEKNWNYLLAVTIDKGEKLDEASRQQRFNTGIRDFDFWLSEAETL
LTMKDQARDLASAGNLLKKHQLLETEMLARQDALQDLNTLATDLICSGTFNTDQIVEKRD
NVNERFLNVKELAAEHHEKLKESYALFQFFQDLDDEEFWIEEKLVRVRSQDYGRDLQGVQ
NLLKKHRRLEGELLAHEPAIQNVLDTAERLGDKAAVGREEIQDRLDQLVQHWDQLKELTK
ARGIQLGESLEYLEFMENAEEEEAWISEKEALVAQGDSGDTLAAIQSLQKKLEALENDFA
VHEIRVQNVCAQGEDILSKGESQHKEKISNKIQALNEKIPALARSLAVWKSQLEDDYDFQ
EFNWKADVVEAWIAEKXTSLKTNSNDADLTALSTLLAKQETLHASLQSFHQERLSEITDL
KDKLVAAEHSQTKAIEERHAALLRRWEQLLEASEVHRQELLEKQRPLLETEVLFMKFAHE
ASAFNNWCEKAEEDLSEPVRCVSLDAIRQLQKDHEAFLASLTKARGDFNDLRELDQQIKA
LNVPSSPYTWLTVEVLERVWKHLLDTIKEREQELEKEEARQIKNFEMCQEFEQNASAFLN
WILETRDYFLDGSLLKETGTLESQLEANKRKQKEIQAKKHQLTKIEDLGESLEEALVLDL
KYSTIGLAQQWDQLYQLGMRRQHSLEEQIQARDITGLSEETRQEFETTFRHFDENLTGRL
SHKDFRSCLRGLNYYLPMVEEGEPEPKFEKFLDAVDPERKGYISKDEYIDFLTDKESENI
RSSDELEDSFQALAEGKAYITKEDMKQALTPEQVSFCASRMQQYVDPRGRSQPAGYDYVG
FINSYFGK
NT seq 7227 nt   +upstreamnt  +downstreamnt
atggagagtgatgggtcagaggtcctggaaacagcagaggagatccaggagaggcgtcag
gaggtgttgagtcggtaccagaggttcaaggaacgggttgctgagaggggtcagaaactt
gaagattcctatcactaccgggttttcctacgagatgttgatgaccatgagaaatggatc
atggagaaaatcaagactgcaagtgataaaagctatgaagacccaacaaacatacagggg
aaatatcagaagcatgcaanntttgaagcagaggtgcaagcaaaatcaagggtccttcct
gatctggaaraaaccagggaaactcgatttcctgaggggcattttgcccatgaggacacc
aagggccatctggaggaactgaaccgcctgtgggacctgctgctggagctgacccaggag
aagggtgccttgctgctgcgggccctggaactccaacagtacttccagaagtgtgccgat
atcttggagtggattggagacaaggaygctctggtgacatcartggagctgggtgaggac
tgggagcgcacagaggttctgcataagaagtttgaagagttccaagcagatatgggagtt
cgaaaggagagagtgaatgaagtgaaccaatatgccaatragtgtgcagaggaaaagcat
cctgagctgccctcgattgagtcaaagcagaaggaggtgaatgcagcctgggaacgtctc
catggtctggctctccaacgacagaaaatgctgtccagtgctgcagaccttcagaaattc
aaaagggatgtgactgaagccatccagtggattaaggagaaggaggctcaagtcacgtct
gaggactatggcaaagaccttgtgagctctgaggcactgtttcacagtcacaagacactt
gagaggagccttgcagtcatgaatgacaaggtgaaggagttatgttccaaagcagacaag
ttgaagctttcccatccttcagatgcagctgaaatccagcagatgaaagaggatctggtc
tctaactgggaacgtattcgcaacttggctaccagcagatatgaaaagctgcaggcttct
tatgggtaccagcggttcttatctgactatgatgagctctcaggttggatggaggaaaag
actgctctgatcaatgctgatgagttgcccatagatgtggctggtggggaagccctactg
gacaggcatcagcagcataagcatgagattgactcttatgatgaccgatttcagtctgct
aatgagactggtcaaactctgctggatgccaatcatgaagcatctgatgaagttctaaaa
aagatgtcattacttacctacaactgggcggctctgctggagctgtgggagaagcgtcgg
cagcagtatgagcagtgcttgaacctgcacctcttctaccgtgacagtgagcaagtagac
agttggatgagcagacaagaggccttcctggaaaacgaggacctcggaaattccctgggc
agtgtagaagcccttcgtcagaagcatgatgactttgaggaagcttttactgcccaggag
gagaagatcacaaccatagacaagactgcaaccaaactgattgatgataagcattatgat
tcagagaagatcgctgctatccgggatgaactgttggtccgacgggacaatctacgaaaa
agggctgccattagacgcggattgctggaggattcattccttctgcagcaactgtatcag
gactcagatgacctaaagaactggatcaacaaaaagaaaaagttggcagatgatgaagat
tacaaggaaacactgaacttgaagagccaggttcaaaagcagaaagtctttgaagaagaa
ttggcagctaatcagatccggcttaataacatacagaaaactggccaggagatgattgac
agcaatcattatgcctccgacaaggtggctgatcgtttgagggaagttgagagcctctgg
attgaactgcagaaggctacagagcagaaagggatccagttgcatgaagcaaataagcag
cttcaatttgaaaataatgcagaagacctgatgcaatggctggaggaagtggaatggcag
gctagatctcaggattatgggaaaggcctagcagatgtgcagaatctgctcaggaaacat
ggcctcctggagtctgctgtggctactcgtcaggatcaggtggacaccctcacagacctg
gcaacatattttgaagaaatcagccatcccgatgctgggaacatacgggaaaggcaagag
tacctggtatcccagtttgaagccctgaaggagcgactggcctaccggaagaataagctc
attgaccttttccacctgtaccagatccaaagagatacagaggatgaggaggcctggatc
caagagacagaaccctcagtggcttccacctaccttggcaaagacctgattacctccaag
aatcttctgaacagacaccatgtcatccaggctaatattgccagccatgagccacacatt
caaatgattacagagaagggaaacaaaatgatagaggaaggacactttgctgcagaagat
gtggcctctagggtcaacagtttgaatgagaatatggaatctctccaggctcgagctact
agacggcagaatgatcttgaagccaatgtccaattccagcagtacctagttgatcttcat
gaagcagaagcatggattagagagaaggaacctatagtagacaacactaactacggggca
gatgaagaagcagctggggctcttctaaagaagcatgaggcctttctagtggatctgaag
gcttttggaaacagtatgcaagctcttcgggatcaggcagaagcctgccaggaacaacaa
gctgcacctgtggaggtggctgctccagaagagagggttgtggccttatatgactttgag
gccctctgctcccgagaagtcaccatgaagaaagatgatgtcttaacactgctcagttcc
atcagcaaggactggtggaaagtagaaactgatgatcaccagggctttgtgccagctgtc
tatgtgaggaaactagcccgtgatgagtttcctatgctcccacaacggaagcgagaagaa
ccaggcaacatcatccagcgccaggaacagattgagaaccagtaccattccctcctgcat
cgggcagacgagcgcagacgtcrtctgttgcaacgttacaatgagtttttgctggcctat
gaggcaggagacatgctggactggatccgagagaaaaaggcagaaaacaccggggtggaa
ttagatgatgtttgggagttacagaaaaagtttgatgagttccaaatggatttgaaggca
aatgaacctcgactgagggatatcaacaaggtggctgatgatcttcaatttgaagagctt
ttgacaccagagggagctcaaatacagcaggagttgaatgcccgatggaggtccttgcag
aggctggcagaggaacagcgccagctgctaggcagtgcccatgctgtccagatgtttcac
agagaagcagatgacacaaaggaacagattgagaagaagtgccaggccctcaatactgct
gaccctggctcagacttattcagtgtgcaggcccttcaacgacagcatgaaaactttgaa
agagatctcgtacctctgggggaaaaggtggaggtactgagggacacagcagatcgactc
agtgaatcccacccagatgccactgatgacctgcagagccagcagttgaagctgaaggag
gcctgggatgacttgcaggggcttacaaaggatcgtaaggagaacctacaggaggcctta
aaattctaccagttcctcagccaggccagggacttacagaattggattagtggcattggt
ggcatggtttcatcccaggaactggctgaagatttaactggcacagagatcatgatagag
cggcatcaggagcatcgtgctgacatggaggcccaggctcccgccttccaggcctttgaa
gattttggtacagatcttacaatcagtgggcaccgggccagccccgaaattgaagaaaag
cttcaagctgttagactagagagagatgagttggagagtgcttgggaacaacgcaaaaag
atgctagatcagtgtctggagttgcagttgttccgagggaactgtgatcaggctgagagc
tggatggtggcacgtgagaatgatctaaggtcggatgataaggggtccttagacactctg
gaggccttgatgaagaaacgtgacgatttggacaaagcgattactgaccaggataataga
atcgctgaactagatctttttgctgaacgactcatatctgaagaccactatgccaaggaa
gagattgctgctcggaaccaacggatactagacagatggaggattctcaaagaacagctg
actgctgagcggatgaaacttggagactatgctgacctaaaacaattctaccatgacttc
aaggaccaagaagaatggatcagtgagatgctgcccatagcctgtgatgaatcctataaa
gatcccaccaatattcagagaaaatatctgaagcacaaggcctttgaagatgaggtcaat
agccgagctgagcaggtggaaggagtcattattttagggaacactctggttgagcggagg
gcatgcgatggtaatgaagagtctgtgaaggatcaagtagaagagttggagaaaaactgg
aactacttgcttgcggtaacaattgacaaaggagagaagctcgatgaagctagtcgccag
cagaggttcaacacaggcatccgggactttgacttctggctctcagaggcagagacactg
ctgaccatgaaggatcaggccagggatctggcttcagcaggaaacttgctcaagaaacat
cagctactggaaacagagatgttggctagacaggatgcactccaggacctgaacacattg
gctacagatctgatctgcagtggaactttcaatactgaccagattgtggagaaaagggat
aatgtcaacgagcgctttctgaatgtcaaggaattggcggctgagcatcatgagaaactg
aaagagtcatatgccttgttccagttcttccaggacctagatgatgaagagttctggata
gaggagaagttggtacgagtgagatcccaggactatgggagggatctgcagggggttcag
aatttgctgaagaagcacagacgcctagaaggggagctgctggcacatgaacctgccatc
cagaatgtactggatacggcagaaaggctgggagacaaggcggccgtggggcgagaggag
atccaggacaggcttgatcagcttgttcaacactgggaccagctcaaagagttgaccaag
gctcgagggattcagttgggagaatccctagaatacttggaattcatggagaatgctgag
gaggaggaagcttggattagtgaaaaggaagctctagttgcccaaggggattctggagac
actttggctgctattcagagcttacaaaagaagctcgaagctttggagaatgactttgct
gtccatgagattcgagtgcaaaatgtgtgtgctcaaggagaagacatcctgagtaagggg
gaaagtcaacataaagagaagatttctaacaagatacaggctctaaatgaaaagattcct
gctctggccaggtcattggctgtttggaagtcacaactggaagatgattatgactttcag
gagttcaactggaaggctgatgtggttgaggcctggatagctgagaaagwaacaagcttg
aagaccaatagcaatgatgcagacctcactgccctctccactctcctggcaaaacaggaa
acactgcatgccagtctgcagagcttccaccaagagagactgtctgagataactgacctg
aaggataagcttgtggctgctgagcacagccagacgaaagccattgaggagcgccatgct
gccttgctgaggcgctgggaacagctgctggaagcctctgaagtccatagacaggaattg
ctagagaaacagcggcccctactggagactgaggttctattcatgaaatttgcacacgag
gcctcagctttcaacaattggtgtgagaaggccgaggaggacctgtcagagcctgtgcgc
tgtgtctccctggatgcaatccggcagctgcagaaggaccatgaggccttcttggcctcc
ttgacaaaggcccgaggagacttcaatgatttgcgagagctagaccagcagattaaggcc
ttaaatgtgccctccagcccctatacctggttaacagtggaggtgctagagagagtctgg
aaacacctattggataccatcaaggaaagagagcaggagttggaaaaggaagaggcaaga
cagatcaagaactttgagatgtgccaggaatttgaacagaatgccagtgccttccttaat
tggatcttggagacaagggactattttctggatggatctttgctgaaagaaacaggaaca
ctagaatcccagctggaagcaaataaaaggaagcaaaaggaaatccaggcaaagaagcat
caactgaccaagattgaggacctgggagaaagcttagaagaggctctggtcctggacctt
aaatatagcaccatcgggctggctcaacagtgggaccagctctaccagcttgggatgcga
aggcaacacagtctagaagaacaaatccaagccagagacatcactggtctcagtgaagag
acacgacaagagtttgaaacaacctttaggcactttgatgagaatttgacaggtcgcttg
agtcacaaagatttccggtcctgcctgagagggctcaattactacttgcccatggtggag
gagggtgaacccgagcccaagtttgagaaattcctggatgctgttgatccagaaagaaag
ggctatatctcaaaagatgagtacatcgacttcttgactgacaaggagtcagagaacatc
agatccagtgatgaactagaagattctttccaagccctggcagagggcaaagcctatatt
acraaagaggacatgaagcaggccctaaccccagaacaagtgtcattctgtgcctcacgt
atgcagcaatatgtggatccccggggccgaagccaacctgctggctatgattacgttggc
ttcatcaattcttactttggcaaataa

DBGET integrated database retrieval system