KEGG   Bos indicus (zebu cattle): 109566525
Entry
109566525         CDS       T04792                                 

Gene name
ENDOG
Definition
(RefSeq) endonuclease G, mitochondrial
  KO
K01173  endonuclease G, mitochondrial
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109566525 (ENDOG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:biu03029]
    109566525 (ENDOG)
Mitochondrial biogenesis [BR:biu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Mitochondrial DNA maintenance factors
    109566525 (ENDOG)
SSDB
Motif
Pfam: Endonuclease_NS
Other DBs
NCBI-GeneID: 109566525
NCBI-ProteinID: XP_019826540
Position
11
AA seq 299 aa
MQLLRAGLTLALGAGLGAAAESWWRQRADARATPGLLSRLPVLPVAAAAGLPAVPGAPAG
GGPGELXKYGLPGVAQLKSRASYVLCYDPRTRGALXXXEQLRPEGLRGDGBRSSCDFHED
DSVHAYHRATNADYRGSGFDRGHLAAAANHRWSQKAMDDTFYLSNVAPQVPHLNQNAWNN
LEKYSRSLTRTYQNVYVCTGPLFLPRTEADGKSYVKYQVIGKNHVAVPTHFFKVLILEAA
GGQIELRSYVMPNAPVDEAIPLEHFLVPIESIERASGLLFVPNILARAGSLKAITAGSK
NT seq 900 nt   +upstreamnt  +downstreamnt
atgcagttgcttcgggccggcttgactctggccctgggcgcagggctgggtgcagctgcc
gagagctggtggcgacagcgagcggacgcgcgggcgacgccggggctgctgagccggctg
ccggtgttgccagtggcggcggcggcggggcttcccgcggtgccaggggctcccgcgggt
ggcggcccgggcgagttagmcaagtatgggctgcccggggtggcgcaactcaagagccgc
gcgtcgtacgtgctgtgttacgacccgcgcacccgcggcgcgctcnnnnnnntcgagcag
ctgcggcccgaggggctccgcggcgacggcraccgcagctcctgcgacttccacgaggac
gactcggtgcatgcgtaccaccgcgccaccaacgccgattaccgcggcagcggcttcgac
cgcggccacctcgctgccgcggccaaccaccgctggagccagaaggcaatggacgacacc
ttctacctgagcaacgtcgcgccccaggtgccacacctcaaccaaaatgcctggaacaac
ctggaaaagtacagccgcagtctgacccgcacctaccaaaatgtctatgtctgcaccggg
ccactcttcctgcccaggacggaggctgatgggaagtcctacgtgaagtaccaagtcatt
ggcaagaaccacgtggcggtgcccacccacttcttcaaggtgctgatcctggaggcggca
ggtgggcagatagaactccgctcctatgtgatgcccaatgcgccggtggatgaggcaatc
ccgctggagcacttcctggtgcccattgagagcattgagcgggcctccgggctgctcttt
gtgccaaacatcctggcacgggcgggcagcctgaaggccatcactgctggcagcaagtaa

DBGET integrated database retrieval system