KEGG   Bos indicus (zebu cattle): 109566563
Entry
109566563         CDS       T04792                                 

Gene name
NTNG2
Definition
(RefSeq) netrin-G2
  KO
K16359  netrin-G2
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04360  Axon guidance
biu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109566563 (NTNG2)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    109566563 (NTNG2)
SSDB
Motif
Pfam: Laminin_N Laminin_EGF EGF EGF_2
Other DBs
NCBI-GeneID: 109566563
NCBI-ProteinID: XP_019826608
Position
11
AA seq 531 aa
MLRLLALLLHCLALASGDYDICKSWVTTDEGPTWEFYACQPKVMRLKDYVKVKVEPSGIT
CGDPPERFCSHENPYLCSNECDASNPDLAHPPRLMFDREDEGLATYWQSVTWSRYPSPLE
ANITLSWNKSVELTDDVVVTFEYGRPTVMVLEKSLDNGRTWQPYQFYAEDCMEAFGMPAR
RARDLSASGAHRVLCTEEYSRWAGSKKEKHVRFEVRDRFAIFAGPDLRNMDNLYTRLESA
KGLKEFFTLTDLRMRLLRPALGGTYVQRENLYKYFYAISNIEVTGRCKCNLHANLCSVRE
GSLQCECEHNTTGPDCGKCKRSFRTRSWRAGSYLPLPHGSPNACAAAGSAVGNCECYGHS
NRCSYIDFLNVVTCVSCKHNTRGQHCQHCRLGYYRNGSAELDDENVCIECNCNQIGSVHD
RCNETGFCECREGAAGPKCDDCLPTHYWRQGCYPNVCDDDQLLCQNGGTCVQNQRCACPR
GYTGARCEQPRCDPADDEGGLECDRAPGAAPXPATLLGCLLLLGLAARLDC
NT seq 1596 nt   +upstreamnt  +downstreamnt
atgctgcgcttgctggccctcctcctgcactgcctggccctggcctccggggactacgac
atctgcaaatcctgggtgaccacggacgaaggccccacctgggagttctatgcctgccag
cccaaggtgatgcgcctgaaggactatgtcaaggtgaaggtggagccctccggcatcacg
tgcggagaccccccggaaagattctgctcccacgagaacccctacctgtgcagcaacgag
tgtgacgcctccaacccagacctggcccacccgccacggctcatgttcgacagggaggac
gagggcctggccacctactggcagagcgtcacgtggagccgctaccccagcccgctggag
gccaacatcaccctctcgtggaacaagagcgtggagctgacggacgacgtggttgtcacc
ttcgagtacggccggcccaccgtcatggtcctggagaagtcgctggacaacgggcggacg
tggcagccctaccagttctacgcggaggactgcatggaggccttcggcatgcccgcgcgg
cgggcgcgcgacctgtcggcgtcgggcgcgcaccgcgtgctgtgcacggaggagtactcg
cgctgggccggctccaagaaggagaagcacgtgcgcttcgaggtgcgggaccgcttcgcc
atcttcgccggccccgacctgcgcaacatggacaacctgtacacgcggctggagagcgcc
aagggcctcaaggagttcttcaccctcaccgacctgcgcatgaggctgctgcggccggcg
ctgggcggcacctacgtgcagcgggagaacctctacaagtacttctacgccatctccaac
atcgaggtcaccggcaggtgcaagtgcaacctgcacgccaacctgtgctccgtgcgtgag
ggcagcctgcagtgcgagtgtgagcacaacaccacgggccctgactgcggcaagtgcaag
aggagcttccgcacgcggtcctggcgcgccggctcctacctgccgctgccccatggctct
cccaacgcatgtgccgccgcaggctccgccgtcggcaactgcgagtgctacggccactcc
aaccgctgcagctacattgacttcctgaatgtggtgacctgcgtcagctgcaagcacaac
acgcggggccagcactgccagcactgccgtctgggctactaccgaaacggctctgcagag
ctggacgacgagaacgtgtgcatcgagtgtaactgcaaccagatcggctccgtgcacgac
cggtgcaacgagaccggcttctgcgagtgccgcgagggtgcggcggggcccaagtgcgac
gactgcctccccacgcactactggcgccagggctgctaccccaacgtgtgcgacgacgac
cagctcctgtgccagaacgggggcacctgcgtgcagaaccagcgctgcgcctgcccgcgt
ggctacaccggcgcgcgctgcgagcagccccgctgcgaccccgccgacgacgagggcggc
ctggaatgcgaccgcgcgccgggggctgccccackccccgccaccctgctcggctgcctr
ctgctgctggggctggctgcccgcctggactgctga

DBGET integrated database retrieval system