KEGG   Bos indicus (zebu cattle): 109566696
Entry
109566696         CDS       T04792                                 

Gene name
CPB2
Definition
(RefSeq) carboxypeptidase B2 isoform X1
  KO
K01300  carboxypeptidase B2 [EC:3.4.17.20]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
biu04972  Pancreatic secretion
biu04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109566696 (CPB2)
  09154 Digestive system
   04972 Pancreatic secretion
    109566696 (CPB2)
   04974 Protein digestion and absorption
    109566696 (CPB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109566696 (CPB2)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.20  carboxypeptidase U
     109566696 (CPB2)
Peptidases and inhibitors [BR:biu01002]
 Metallo peptidases
  Family M14: carboxypeptidase A family
   109566696 (CPB2)
SSDB
Motif
Pfam: Peptidase_M14 Propep_M14
Other DBs
NCBI-GeneID: 109566696
NCBI-ProteinID: XP_019826801
Position
12
AA seq 423 aa
MKLYSLGVLVATVLFCGEHAFAFQRGQVLSALPRTSRQVQILQNVTTTYKIVLWQPVAAE
YIVKGYEVHFFVNASDVSNVKAHLNASRIPFRVLVENVEDLIRQQTSNDTISPRASSSYY
EQYHSLNEIYSWIEVMTERYPDMVEKIHIGSSYEKYPLYVLKVSKKEQRAKNAMWIDCGI
HAREWISPAFCLWFVGSVTYYYGKEKMYTNLLKHMDFYIMPVVNVDGYDYTWKKDRMWRK
NRSLHEKNACVGTDLNRNFASKHWCGEGASSSSCSEIYCGTYPESEPEVKAVADFLRRNI
KHIKAYISMHSYSQKIVFPYSYSRSRSKDHEELSLVAREAVFAMENIHRNIRYTHGSGSE
SLYLAPGGSDDWIYDLGIKYSFTFELRDKGKYGFLLPESYIRPTCSEALVAVAKIASHVV
KNV
NT seq 1272 nt   +upstreamnt  +downstreamnt
atgaagctttatagcttgggagtccttgtcgccaccgtcctgttctgtggggagcatgcc
ttcgcctttcagaggggccaggttttatctgctcttcctagaacctccaggcaagttcaa
attctgcagaatgttactacaacatacaagattgttctctggcagccagtagcagctgaa
tatattgtgaagggatacgaagtccatttttttgtgaatgcatctgatgtaagcaatgtg
aaagcccatttaaatgcgagcagaattccattcagggtcctggtggaaaatgtggaagat
cttatccggcagcagacttccaatgacaccatcagcccccgggcatcctcctcctactat
gaacagtatcactcactaaatgagatctattcttggatagaagttatgactgagcggtat
cctgatatggttgaaaaaatccacattggatcctcatacgagaagtacccactttatgtt
ttaaaggtttctaaaaaagaacaaagggccaaaaatgccatgtggattgactgtggaatc
cacgccagagagtggatctctcctgctttctgcttgtggttcgtgggctctgtaacttat
tactacgggaaagaaaagatgtataccaatcttctgaagcacatggatttctatattatg
ccagtggttaatgtggatggttatgactacacatggaaaaaggatcgaatgtggagaaag
aatcgttctttacatgaaaaaaatgcttgtgtcggaacagacctgaacaggaactttgcc
tccaaacactggtgtggagagggtgcctcaagttcctcgtgctcagaaatctactgtgga
acttaccctgagtcggaaccagaagtgaaggcggtggctgatttcttgagaagaaatatc
aagcacattaaagcttacatcagcatgcattcctactcccagaagatagtgtttccatat
tcctacagccgaagcagaagcaaagaccacgaggagctgtctctagtggccagagaagca
gtcttcgctatggagaatattcatagaaatatcagatacacacatggcagtggttcagaa
agtttatatctagctcctggaggttcagacgactggatctatgacttgggcatcaaatat
tcgtttacatttgaacttcgagataaaggcaaatatggattcttgctgccagagagttac
atcagacccacgtgttcagaagctctagttgctgtcgctaaaatagcttcgcatgtcgtc
aagaatgtttaa

DBGET integrated database retrieval system