KEGG   Bos indicus (zebu cattle): 109567023
Entry
109567023         CDS       T04792                                 

Gene name
F7
Definition
(RefSeq) coagulation factor VII isoform X1
  KO
K01320  coagulation factor VII [EC:3.4.21.21]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109567023 (F7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109567023 (F7)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.21  coagulation factor VIIa
     109567023 (F7)
Peptidases and inhibitors [BR:biu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   109567023 (F7)
SSDB
Motif
Pfam: Trypsin Gla FXa_inhibition DUF1986 EGF cEGF hEGF Trypsin_2 EGF_2
Other DBs
NCBI-GeneID: 109567023
NCBI-ProteinID: XP_019827334
Position
12
AA seq 451 aa
MLSQAWALALLCFLLSLWGSLPAARPPVFLPQEQALSILHRPRRANGFLEELLPGSLERE
CREELCSFEEAHEIFRNEERTRQFWVSYNDGDQCASSPCQNGGSCEDQLQSYICFCPDGF
EGRNCETDKQSQLICANDNGGCEQYCGADPGAGRFCWCHEGYALQADGVSCAPTVEYPCG
KIPVLEKRNGSKPQGRIVGGHVCPKGECPWQAMLKLNGALLCGGTLVGPAWVVSAAHCFE
RLRSRGNLTAVLGEHDLSRVEGPEQERRVAQIIVPKQYVPGQTDHDVALLQLAQPVALGD
HVAPLCLPDPDFADQTLAFVRFSAVSGWGQLLERGVTARKLMVVLVPRLLTQDCLQQSRQ
RPGGPVVTDNMFCAGYSDGSKDACKGDSGGPHATRFRGTWFLTGVVSWGEGCAAAGHFGI
YTRVSRYTAWLRQLMGHPPSRQGFFQVPLLP
NT seq 1356 nt   +upstreamnt  +downstreamnt
atgctgtcccaggcctgggctctggccctcctctgctttctgctcagcctgtgggggtcc
ctgccggcagcacgccccccagtcttcctgccccaggagcaggccctcagcatcctgcat
cggcctcggcgtgccaacgggttcctggaggagctgctgccgggctcgctggagcgggag
tgcagggaggagctctgctccttcgaggaagcccacgagatcttccgcaacgaggagagg
acgaggcagttctgggtttcctacaatgacggggaccagtgcgcctccagcccctgccag
aacgggggctcctgtgaggaccagctccagtcctacatctgcttctgccccgacggcttc
gagggccggaactgtgagaccgacaagcagagccagctgatctgcgccaacgacaatggc
ggctgtgagcagtactgtggggccgacccgggggccgggcgcttctgctggtgccatgag
ggctacgcgctccaggcagacggggtgtcctgcgcgcccacagtggaatatccgtgcggg
aaaatacctgttctggaaaaaagaaatggcagcaagccccaagggcgaattgtggggggc
cacgtctgccccaaaggggaatgcccctggcaggccatgctgaagctgaacggggcgctg
ctgtgcgggggcaccctggtcggcccggcctgggtggtctccgccgcccactgcttcgaa
aggctccggagyagggggaacctgacggctgtgctgggcgagcacgacctcagccgcgtg
gagggcccagagcaggagcggcgggtggcgcagatcattgtccccaagcagtacgtgccg
ggccagacggaccacgacgtggccctgctgcagctggcccagcccgtggccctgggcgac
cacgtggcacccctctgtctgcccgacccggacttcgcggaccagacgctggccttcgtg
cgcttctcggccgtcagcggctggggccagctcctggagcgcggggtcaccgcccgcaag
ctcatggtggtgctggtgccccggctgctgacccaggactgcctgcagcagtcgcgccag
aggcccggcgggcctgtggtcacggacaacatgttctgcgctggctatagcgacggcagc
aaggatgcctgcaagggggacagcgggggcccgcacgccacacgcttccggggcacctgg
ttcctgaccggcgtcgtcagctggggcgagggctgcgcggcagccggccactttgggatc
tacacgcgggtctcccgctacacggcctggctgcggcagctgatgggccacccgccrtcc
aggcagggcttcttccaggtcccgctgctgccctag

DBGET integrated database retrieval system