KEGG   Bos indicus (zebu cattle): 109567024
Entry
109567024         CDS       T04792                                 

Gene name
F10
Definition
(RefSeq) coagulation factor X
  KO
K01314  coagulation factor X [EC:3.4.21.6]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109567024 (F10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109567024 (F10)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109567024 (F10)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.6  coagulation factor Xa
     109567024 (F10)
Peptidases and inhibitors [BR:biu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   109567024 (F10)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Haparin
  Coagulation and fibrinolysis
   109567024 (F10)
SSDB
Motif
Pfam: Trypsin Gla FXa_inhibition EGF Trypsin_2 DUF1986 cEGF hEGF EGF_3 EGF_CA
Other DBs
NCBI-GeneID: 109567024
NCBI-ProteinID: XP_019827336
Position
12
AA seq 492 aa
MAGLLHLVLLSTALGGLLRPVGSVFLPRDQAHRVLQRARRANSFLEEVKQGNLERECLEE
ACSLEEAREVFEDAERTDEFWSKYKDGDQCEGHPCLNQGHCKDGIGDYTCTCAEGFEGKN
CEFSTREICSLDNGGCDQFCREERSEVRCSCAHGYVLGDDSKSCVSTERFPCGKFTQGRS
RRWAIHTSEDALDASELEHYDPADLSPTESSLDLLGLNRTEPSAGEDGSQVVRIVGGRDC
AEGECPWQALLVNEENEGFCGGTILNEFYVLTAAHCLHQAKRFTVRVGDRNTEQEEGNEM
AHEVEMTVKHSRFVKETYDFDIAVLRLKTPIRFRRNVAPACLPEKDWAEATLMTQKTGIV
SGFGRTHEKGRLSSTLKMLEVPYVDRSTCKLSSSFTITPXMFCAGYDTQPEDACQGDSGG
PHVTRFKDTYFVTGIVSWGEGCARKGKFGVYTKVSNFLKWIDKIMKARAGAXGSRGHSEA
PATWTVPPPLPL
NT seq 1479 nt   +upstreamnt  +downstreamnt
atggcgggcctgctgcatctcgtcctgctcagcaccgccctgggcggcctcctgcggccg
gtggggagcgtgttcctgccccgggaccaggcccaccgtgtcctgcagagagcccgcagg
gccaactcattcttggaggaggtgaagcagggaaacctggagcgagagtgcctggaggag
gcctgctcactagaggaggcccgcgaggtcttcgaggacgcagagcggacggatgaattc
tggagtaaatacaaagatggagaccagtgtgaaggccacccgtgcctgaatcagggccac
tgtaaagacggcatcggagactacacctgcacctgtgcggaagggtttgaaggcaaaaac
tgcgagttctccacgcgtgagatctgcagcctggacaatgggggctgcgaccagttctgc
agggaggagcgcagcgaggtgcggtgctcctgcgcgcacggctacgtgctgggcgacgac
agcaagtcctgcgtgtccacagagcgcttcccctgtgggaagttcacgcagggacgcagc
cggcggtgggccatccacaccagcgaggacgcgcttgacgccagcgagctggagcactac
gaccctgcagacctgagccccacagagagctccttggacctgctgggcctcaacaggacc
gagcccagcgccggggaggacggcagccaggtggtccggatagtgggcggcagggactgc
gcggagggcgagtgcccatggcaggctctgctggtcaacgaagagaacgagggattctgc
gggggcaccatcctgaacgagttctacgtcctcacggctgcccactgcctgcaccaggcc
aagaggttcacggtgagggtcggcgaccggaacacagagcaggaggagggcaacgagatg
gcacacgaggtggagatgactgtgaagcacagccgctttgtcaaggagacctacgacttc
gacatcgcggtgctgaggctcaagacgcccatccggttccgccggaacgtggcgcccgcc
tgcctgcccgagaaggactgggcggaggccacgctgatgacccagaagacgggcatcgtc
agcggcttcgggcgcacgcacgagaagggccgcctgtcgtccacgctcaagatgctggag
gtgccctacgtggaccgcagcacctgtaagctgtccagcagcttcaccatcacgcccarc
atgttctgcgccggctacgacacccagcccgaggacgcctgccagggcgacagtggcggc
ccccacgtcacccgcttcaaggacacctacttcgtcacaggcatcgtcagctggggagaa
gggtgcgcgcgcaagggcaagttcggcgtctacaccaaggtctccaacttcctcaagtgg
atygacaagatcatgaaggccagggcaggggccgygggcagccgcggccacagtgaagcc
cctgccacctggacggtcccgcccccccttccgctctga

DBGET integrated database retrieval system