KEGG   Bos indicus (zebu cattle): 109567191
Entry
109567191         CDS       T04792                                 

Gene name
SIGLEC1
Definition
(RefSeq) sialoadhesin isoform X1
  KO
K06548  sialoadhesin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109567191 (SIGLEC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109567191 (SIGLEC1)
   04091 Lectins [BR:biu04091]
    109567191 (SIGLEC1)
CD molecules [BR:biu04090]
 Proteins
  109567191 (SIGLEC1)
Lectins [BR:biu04091]
 I-type lectins (Siglecs)
  109567191 (SIGLEC1)
SSDB
Motif
Pfam: Ig_2 Ig_3 I-set ig V-set Ig_4 C2-set_2 Ig_5 Izumo-Ig C1-set PepSY_TM
Other DBs
NCBI-GeneID: 109567191
NCBI-ProteinID: XP_019827492
Position
13
AA seq 1713 aa
MDFLLQLLLLALPIPADLISWGVSSPETVKGMKGSCLVIPCTFSFPASVNVPDGITTIWY
YDYSGRRQVVSHSTKPQLVEARFQGRAQMVGNPELRVCNLLLKDLQPEDSGSYNFRFEIS
EGNRWVDVKGTAVTVTEELIMPTVASPAELHEGMEVDFNCSTPYACLQEPVTLRWQGQDP
ARSTTSTLQKLEPTGIHHQETLHMALSWQDHGRTLSCQLSAANHKTQREIHLQVQYAPKG
VEILLSPSGRNILPGDLVTLICQVNSSHPQVSSVQWVKDGTHLKNRSRVLQLPRAAWADA
GVYTCEAGNGVGSSVSPPVSLHIFMAAVQVSPAGSILENQTVTLACNTPKEAPRELRYAW
YKNHELMKATHSRILQLHSVTRADTGFYFCEVQNAQGRERSDPVSVVVRHPPLTPHLTAF
LETQEGLVGILQCSVVSEPLAXLVLSHEGLVLASTSGEGDQSPRFSVYSAPNSLRLEIRD
LGPTDSGEYMCSATNSLGNSSSTLDFHANVARLLISPAAEVAEGQAVTLSCRSSLSPMSD
TRFSWYRNGALLLEGPSSSLLLPVVSSTDAGSYHCRAQDGHGTSGLSSPAVLTVLYAPRR
PTFTAQLDPDTAGAGQRGLLLCRVDSDPPAQLRLFHRGRVVAXSLPSGGSCSACGSCSPR
TKVTRAPNLLRVEIQDPVLEDEGVYLCEASNALGNASASANFNAQATVLVITPSHTLQEG
TGANLTCRVSREAGGPANFTWFRDGALWAQGPLETLTLLPVARTDAALYACRILTEAGAQ
LSTPVVLQVLYPPDPPKLSALLDVDQGHTAVFVCTVDSRPPAQLALFHGEHLLATSPGPQ
LPSRGHLQAKTTANFLQLEVQDLSLKDSGSYRCEANNALGSSNTSLFFQVRGAWVQVSPS
PELREGQAVVLSCQVPTGVLEGTSYRWYRDGQPLQEFTSATIRFAAITLSQAGAYHCQAQ
APGSATTNLAAPVSLHVSYAPRQATLTTLMDTGPGRLGLLLCRVNSDPPAQLRLLHGDRL
VTSTLQGVGELAGSSPRLQVAVAPNTLRLEIHNAVLEDEGVYTCEATNALGQALASATFD
AQAVSVQVWPKATVQEGQLVNLTCLVWTTLTQLTYTWYQDGQQRPDAAQSIALPNVTVVD
ATSYSCGVLIPGQTLHRSRPVTLDVLYAPRSLRLTYLLESRGGQLALVLCTVDSRPPAQL
VLSHAGRLLASSTTASVPNTLQLELWEPGPSDEGLYSCSAHSPLGQVNTSLELRLEVVQV
TLAPSATVPEGAPITVSCEDPAARPPTLYAWYHNSRWLQEGPEASLSFPVVTRAHAGAYT
CQVRDAQGTRSSRPTALHVLYAPRDAAVSSFWDSRSSPMAVVQCTVDSEPPAELALARNG
KVLATSNGIPGLAVETGHVQVARNALRLRVQAVPSGDEDTYVCTARNLLGSVSTTLGQLQ
AEGVHVVAEPGLDVPEGAALNLSCQLPGGPGLMGNSTFTWFWNGXRLHTEPVPTVAFTHV
ARDQAGMYHCQAELPTGATASAPVTLRVLYPPKTPTMTVFVEPEGGIQGILDCRVDSEPL
ASLTLHLGSRLVASSQSKVAPAKPHIHVSVTPNALRVVIEELRPSDQGEYVCSASNSLGS
ASAATYFGTRALHRLQLFQQLLWVLGLLAGLLSLLLGLGAYYTWRRRNFHKLREGENSVE
MASQKETMQEEEVTRICDDSDPVNNAALGPDSL
NT seq 5142 nt   +upstreamnt  +downstreamnt
atggacttcctgctccagctcctcctcctggccttacccatcccagcagacctgatctcr
tggggcgtctccagtcccgagaccgtgaagggtatgaaggggtcctgcctcgtcatcccc
tgcaccttcagcttccctgccagtgtgaatgtgcccgatggcatcacaaccatctggtac
tatgactactcaggcagacggcaggtagtgagtcactccacaaagccccagctggtggag
gcccgcttccaaggccgtgcccagatggtggggaatcctgagctcagggtgtgcaacctg
ctgctgaaggacctgcagcctgaggactcaggctcctacaacttccgcttcgagatcagc
gagggcaaccgctgggtagatgtcaaaggcacagcagtcactgtgacagaggagctcatc
atgcccaccgttgcctctccggctgagctgcatgagggcatggaggtggacttcaactgc
tccactccgtacgcgtgcctgcaggagccagtcacccttcggtggcaaggccaggaccct
gcccgctccaccacctccacactccagaagcttgagcccacgggcatccaccaccaggag
accctccacatggccctgtcctggcaggaccatggccggaccttgagctgccagctctcg
gcagccaaccataagactcagcgtgagattcacctccaagtgcagtatgcccccaagggt
gtagaaatcctcctcagcccctcggggcggaacatccttccaggggatctggtcacactc
atctgccaggtgaacagcagtcaccctcaggtcagttctgtgcagtgggtcaaggatggg
acgcacctcaaaaaccggagtcgtgtactacagttgccccgggcagcctgggctgatgct
ggcgtctacacctgtgaagctgggaatggcgtgggctcttcggtctcacctcctgtcagc
ctccacatcttcatggctgcggtccaggtgagcccagcaggctcgattctggagaaccag
actgtgacgctggcctgcaacacaccgaaagaagcgcccagggagctgcgctacgcatgg
tacaaaaaccacgagctgatgaaggccacccacagtcgcatcctccagctgcactcagtc
accagggccgatacgggcttctacttctgtgaggtgcagaatgcccagggcagagagcgc
tctgacccagtcagcgtggtggtccgccacccacccctcaccccacacctaactgccttc
ctggagacgcaggagggactggtgggcatcctccagtgctctgtggtcagcgagcccctg
gctwctctggtgttgtcacatgagggcctcgtcctcgcctcaacttccggagagggtgac
cagagcccacgcttcagtgtctactctgccccaaactccctgcgcctggagattcgagac
ctggggccaacagacagtggggagtacatgtgctcagccaccaattcccttgggaattca
tcctccaccctggacttccatgccaatgtggcccgcctcctcatcagcccagcagcagaa
gtggcagaagggcaggcggtaacacttagctgtaggagcagcctgagcccaatgtctgac
acccgcttctcctggtaccggaatggggccctgcttcttgaggggcccagcagcagcctc
ctgctccctgtggtctccagcactgatgccggctcataccactgtcgggcccaggatggc
catggcaccagcgggctctcctcacctgctgtcctcaccgtcctctatgccccacgccgg
cccacgttcactgcccagctggaccctgacaccgccggagccggtcaacgaggcctcctg
ttgtgccgtgtggacagcgaccccccggcccagctgcggctgttccacaggggtcgagtg
gtggcctsttccctgccatcagggggcagctgtagtgcctgcgggagctgttccccacgc
acaaaggttaccagagcccccaacctgttgcgggtagagatccaagacccggtgctggag
gacgagggcgtgtacctctgcgaggccagcaacgccctgggcaacgcctctgcctcagca
aacttcaatgcccaggccaccgtcctggtcatcacaccgtcgcacacgttgcaggaaggc
actggagccaacctgacttgcagggtgagccgggaagctggcggccctgccaacttcacc
tggttccgagatggggccctgtgggcccagggccccctagagaccctgacgctgctgcct
gtggccagaacagatgccgccctgtatgcctgccgcatccttaccgaggccggtgcccag
ctctccacccctgtggtcctgcaagtgctctaccctccagaccctccaaagctgtctgct
ctcctggatgtggaccagggccacacagctgtgtttgtctgcactgtggacagtcgccct
cctgcccagctggcactgttccacggcgagcacctcttggccaccagcccagggccccag
cttccatcccgtggccacctccaggccaaaaccacagccaacttcctgcagctagaggtc
caagacttgagccttaaggactctggcagctaccgctgtgaggccaacaatgccctggga
tcatctaacacttcccttttcttccaggtccgaggagcctgggtccaggtgtcaccatcg
cctgagctccgggagggccaggctgtggtcctgagctgccaagtacccacaggggtcctg
gaggggacctcataccgttggtaccgagatggccagcccctccaggagttcacctcagcc
acaatccgttttgcagccataactttgagccaagctggggcctaccattgccaagcccag
gctcccggctcagccaccacgaacctggcagccccggtcagcctccatgtgtcttatgcc
cctcgccaggccacactcactaccctcatggacacaggccctgggcgactgggcctcctc
ctgtgccgtgtgaacagtgaccctccagcccagctacgactgcttcacggggaccgcctc
gtgacctctaccctgcaaggagtgggggagcttgcggggagctctccccggctacaggtg
gctgtggcccccaacacgctgcgcctggagattcacaatgcagtgctggaggatgaaggc
gtctatacctgcgargccaccaacgccctaggccaggccttggcctcagccacctttgat
gcccaagctgtgagtgtgcaggtgtggcccaaagccaccgtgcaggaggggcagctggtg
aacctcacctgccttgtatggaccactctgacccagctcacctacacatggtaccaagat
gggcagcagcgcccagatgctgcccagtccatcgccctccccaatgtcacggtcgtggac
gccacctcctacagctgcggcgtgttgatccctggccagacgctccatcgctctaggcct
gtcaccctggatgtcctctatgcaccccgcagcctgcgcctgacctatctcctggagagc
cgtggcgggcagcttgccctggtgctgtgcaccgtggacagccgtccacctgctcagctg
gtcctcagccatgctggccgcctcctggcctcctcgaccacagcctcagtccccaacacc
ctgcagctggagctgtgggagcccgggcccagcgatgagggtctctacagctgctcagcc
cacagtcctctgggtcaggtcaacacatccttagagctgcggctagaggttgtgcaggtg
accctggctccatcagccactgtgcccgagggagcccctatcacagtgagctgtgaagac
cctgctgcccgcccacccaccctctatgcctggtaccacaatagccgttggctgcaggag
gggccagaggcctctctctccttcccggtggttacacgggctcacgcaggagcctatacc
tgtcaggtccgggatgcccagggtacacgcagctcccggcccacagcgctgcatgtcctc
tatgccccccgggacgccgctgtgtcctccttctgggactcaaggagcagccccatggct
gtggtacagtgcaccgtggacagtgagccgcctgccgagctggccctggcccgcaatggc
aaagttctggccaccagcaacggcatccctggcttggcagtggagacgggccatgtccag
gtggcccgcaatgccctgcggctgcgagtgcaagctgtgccctcaggggacgaggacacc
tacgtctgcacggctcgcaacttgctgggctcagtcagcaccaccttggggcagctgcag
gcagaaggtgtgcatgtggtggccgagccagggctagatgtgcccgagggcgcagcactg
aacttgagttgtcagctccctggtggccctgggctcatgggcaactccaccttcacttgg
ttctggaatggccrgcgactacacacggagcctgtgcccaccgtcgccttcacccacgtg
gcccgcgaccaagctgggatgtaccactgccaggctgagctccccactggggccaccgcc
tctgctccagttaccctccgggtgctctatccccccaagacacccacgatgacggttttt
gtggagcctgagggtggcatccaaggcattctggaytgccgagtagacagcgagcccctg
gccagcctgaccctccaccttggcagtcggctggtggcctctagccagtccaaggttgct
cctgccaagccacacatccatgtctcagtcacccccaatgccttgagggtggtcatagag
gagctgaggcccagtgaccagggggaatatgtgtgctcygcctctaattccctgggctct
gcctctgctgccacctactttggaaccagagccctgcaccgcctgcagctgttccagcag
ctcctctgggtcctgggactgctggctggccttctctcccttctgctgggcctgggggcc
tactacacctggagaaggaggaattttcataagctgagagagggtgaaaattcagtggag
atggcttctcagaaggaaaccatgcaggaggaggaagtcaccagaatctgtgatgactcg
gaccctgtgaacaatgcagcgttgggtcctgactccctctga

DBGET integrated database retrieval system