KEGG   Bos indicus (zebu cattle): 109567280
Entry
109567280         CDS       T04792                                 

Gene name
CDH4
Definition
(RefSeq) cadherin-4
  KO
K06797  cadherin 4, type 1, R-cadherin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109567280 (CDH4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:biu04515]
    109567280 (CDH4)
Cell adhesion molecules [BR:biu04515]
 Cadherins
  Major cadherins
   109567280 (CDH4)
SSDB
Motif
Pfam: Cadherin Cadherin_C Cadherin_pro Cadherin_3 He_PIG Stevor DUF5527
Other DBs
NCBI-GeneID: 109567280
NCBI-ProteinID: XP_019827660
Position
13
AA seq 914 aa
MTAGSGVLLVLLSLSGALRAHNGDLTARETCKAGFSEEDYTALISQNILEGEKVLKVKFS
SCLGTKGTHYETNSMDFKVGADGTVFATRELRIPSEQVAFTVTAWDHQTAERWDAAVRLL
VAQTSSTHSGHKKGKKNTVPDPVQPPKDTLLPWPQRQSSNGLRRQKRDWVIPPINVPENS
RGPFPQQLVRIRSDKDNDIPIRYSITGVGADQPPMXVFSIDSMSGRMYVTRPMDREERAS
YHLRAHAVDMNGNKVENPIDLYIYVIDMNDNRPEFLNQVYNGSVDEGSKPGTYVMTVTAN
DADDATTANGMVRYRIVTQTPQSPSQNMFTINSETGDIVTVAAGLDREKVQQYMVIIQAT
DMEGNLNYGLSNTATAIITVTDVNDNPPEFTASTYAGEVPENRVEMVVANLTVMDRDQPH
SPNWNAVYRIISGDPSGHFSVRTDPTTNEGMVTVVKAVDYELNRAFMLTVMVSNQAPLAS
GIQMSFQSTAGVTISVMDINEAPYFPSNHKLIRLEEGVPTGTVLTTFSAVDPDRFMQQAV
RYSKLSDPANWLHINATNGQISTAAVLDRESLYIKNNVYEATFLAADNGIPPASGTGTLQ
IYLIDINDNAPELLPKEAQVCEKPSLNAINITAADADVDPNIGPYVFELPFVPASVRNNW
TVTRLNGDYAQLSLRVLHLEAGVYDVPITVTDSGNPPLSHTSIIKVKVCPCDDNGDCTTV
GAVAAAGLGTGAIVAILICIVMLLTMVLLFVMWMKRREKERHTKQLLIDPEDDVRDNILK
YDEEGGGEEDQDYDLSQLQQPEAMEHVLSKAPGVRRVDERPVGAEPQYPVRPVVPHPGDI
GDFINEGLRAADNDPTAPPYDSLLVFDYEGSGSTAGSVSSLDSSSSGDQDYDYLNDWGPR
FKKLADMYGGGEED
NT seq 2745 nt   +upstreamnt  +downstreamnt
atgaccgcgggctcgggcgtgctcctcgtgctgctttcgctctccggcgcgctccgggcc
cacaatggggatcttacagccagggagacctgcaaggctggattctctgaagaagattac
acagcattaatctcccagaatattctggaaggagagaaggtcctcaaagtcaagttcagc
agctgcctggggaccaaggggacgcactacgagaccaacagcatggacttcaaggtyggg
gccgacgggacggtcttcgccacccgggagctgcgcatcccctctgagcaggtggccttc
accgtgacggcatgggaccaccagacggctgagcgctgggacgctgcagtgcggctgctg
gtggcccagacctcgtccacgcactccggacacaagaaaggaaagaagaacacagtcccg
gaccccgtccagcctccgaaagacacgctgctgccatggccacagcgccagagctccaac
gggctgagaaggcagaaacgggactgggtcatcccacccatcaacgtgccagagaactct
cgcgggcccttcccgcagcagctggtgaggatccgrtccgacaaggacaacgacatcccc
atccgatacagcatcacaggcgtgggcgccgaccagccccccatgkaggtcttcagcatc
gactccatgtccggccggatgtatgtcacgcggcccatggaccgggaggagcgagcctcc
taccacctccgagcacatgctgtggacatgaacggcaacaaggtggagaaccccatcgac
ctrtacatctacgtcattgacatgaacgacaaccgcccygagttccttaaccaggtgtac
aacggctccgtggaygaaggctccaagccaggcacctacgtgatgacagtcacagccaac
gacgcggatgacgccaccacagccaacgggatggtgcgctaccggatcgtgacccagacc
ccgcagagcccctcccagaacatgttcaccatcaacagtgagacgggcgacattgtgaca
gtggctgctggcctggaccgagagaaagtccagcagtacatggtcatcattcaggccaca
gacatggaaggaaacctgaactatggcctctccaacacagccaccgccatcatcacagtg
acggatgtgaacgacaacccaccggagttcactgccagcacgtacgcaggggaagtccca
gaaaaccgggtggagatggtggtagcgaatctcacagtgatggaccgagatcagccgcac
tccccgaactggaatgccgtctaccgcatcatcagtggggacccctcgggccacttcagc
gtccgcacggaccccaccaccaacgagggcatggtcaccgtggttaaggcagtcgactac
gagctgaacagagcattcatgctgaccgtgatggtgtccaaccaggcgcccctggccagy
gggatccagatgtccttccagtccacggcgggggtgaccatctccgtcatggacatcaac
gaggccccctatttcccctccaaccacaagctgatccgcctggaggagggtgtgcccact
ggcactgtgctcaccacattctcagcagtggaccccgaccggttcatgcagcaggctgtg
agatactcaaagctttcagacccggcgaactggctacacattaacgccaccaatggccag
atcagcacagcggccgtgcttgaccgcgagtctctctacatcaagaacaacgtctatgag
gccaccttcctggcagctgacaacgggattcccccggccagtggtactgggaccctccag
atctatcttatcgacatcaacgacaacgcccccgagctgctgcccaaggaggcacaggtc
tgtgagaagcccagcctcaatgccatcaacatcacagcggctgatgctgacgtggacccc
aacatcgggccctatgtcttcgagctgccctttgtcccggcgagcgtgcgcaacaactgg
actgtcacccgccttaatggtgactacgcccagctcagcctgcgcgtcctgcacctggag
gccggggtgtacgacgtccccatcacggtcacagactcggggaacccgccgctgtcccac
acgtccatcatcaaagtcaaggtgtgcccatgcgacgacaacggcgactgcaccaccgtg
ggcgcagtggcagcggccgggctgggcacgggtgccatcgtggccatccttatctgcatc
gtcatgctgctcaccatggtcctgctcttcgtcatgtggatgaagcggcgggagaaggag
cggcataccaagcagctgctcattgaccccgaggacgatgtgcgggacaacatcctcaag
tacgacgaggaagggggcggcgaggaggaccaggactacgacctcagccagctacagcag
ccagaggccatggagcatgtgctgagcaaggcccctggggtgcggcgggtggacgagagg
cccgtgggcgccgaaccccagtacccagtaaggcccgtggtgccccacccgggagacatc
ggcgacttcatcaacgagggactgcgcgcagccgacaatgaccccacggcgcccccgtac
gactcgctgctggtgtttgactacgagggcagcggctccacagcgggctccgtcagctcc
ctggactcctccagctccggagaccaggactatgactacctgaacgactgggggcccagg
ttcaagaagctggcggacatgtacggaggcggcgaggaggattaa

DBGET integrated database retrieval system