KEGG   Bos indicus (zebu cattle): 109567397
Entry
109567397         CDS       T04792                                 

Gene name
PROCR
Definition
(RefSeq) endothelial protein C receptor
  KO
K06557  protein C receptor, endothelial (EPCR)
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109567397 (PROCR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109567397 (PROCR)
CD molecules [BR:biu04090]
 Proteins
  109567397 (PROCR)
SSDB
Motif
Pfam: MHC_I_3 MHC_I
Other DBs
NCBI-GeneID: 109567397
NCBI-ProteinID: XP_019827870
Position
13
AA seq 241 aa
MLTTLLPLLPLLLPGWALCSQEASDGPWDLHMTQVSYFRNPSQVWHRGNATLGGVLTHVL
EGPGRNVSIQQLQPLQEPDSWALTKIYLNRYLEEFVGLVQVVHQERGVTFPLIIRCFLGC
ELPPEGSEARVFFEVAVNGSSFVNFQPKTASWVAEPHAPSRVVTYTVDQLNKYNRTRYEL
REFLQDTCVQYIQKHITTNNLKGSQTGRSYTSLVLGVLVGCFIVTGVAVGIFLCTGGRRR
C
NT seq 726 nt   +upstreamnt  +downstreamnt
atgttgacaacactgctgcccctgctgccactgctcctgcccggctgggccctctgcagc
caggaagcctcagatggcccgtgggacctccacatgacccaggtctcctacttccgcaac
ccctctcaagtgtggcaccggggcaacgcgacgctggggggggtcctgacgcacgtgctg
gaaggcccaggccgcaatgtctcgatccaacagctgcagcccttgcaggagcccgacagc
tgggcactcacgaagatatacctgaatcgctacctggaggarttcgtgggcttggtgcag
gtggtgcaccaggagcggggcgtgacctttcctctgatcattcgctgcttcctgggctgc
gagttgcctcctgagggctcggaagcccgtgtcttcttcgaagtggctgtgaatgggagc
tcctttgtaaatttccagccaaaaacagcctcatgggtggcggaacctcatgcaccatcc
agagtggtcacctacacggttgaccagctaaacaagtacaatcgaactcggtacgaactg
agggaatttctacaggacacctgtgtgcaatacatacagaaacacatcaccacgaacaac
ttgaaaggaagccaaacaggccgttcctacacttcactggtcctgggcgtcctggtgggc
tgtttcatcgtcactggagtggctgtaggcatcttcctgtgcacaggtggacggcggcgg
tgttga

DBGET integrated database retrieval system