KEGG   Bos indicus (zebu cattle): 109567486Help
Entry
109567486         CDS       T04792                                 

Gene name
PIGT
Definition
(RefSeq) GPI transamidase component PIG-T isoform X1
  KO
K05292  GPI-anchor transamidase subunit T
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
biu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:biu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    109567486 (PIGT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gpi16
Motif
Other DBs
NCBI-GeneID: 109567486
NCBI-ProteinID: XP_019828027
Position
13
AA seq 579 aa AA seqDB search
MAAPVRIFLLVLLLLGPGGWGRAEPPRDSLREELVITPLPSGDVAATFQFRTRWDSELQR
EGVSHYRLFPKALGQLISKYSLRELHLSLTQGFWRTRYWGTPFLQAPSGAELWAWFQDTV
TDVDESWKELSNVLSGIFCASLNFIDSTNTVTPTASFKPLGLANGTDHSFLRYAVLPREV
VCTENLTPWKKLLPCSSKAGLSVLLKADRLFHTSYHSQAVHIRPVCRNARCTSVSWELRQ
TLSVVFDAFVTGQGKKDWSLFRMFSRTLTEPCPLASESRVYVDVTSYGQDNETLEVYPPP
LTTYQDVILGTRKTYAVYDLLDAAVVSNSRSLNIQLKWKRPPENAEAPPVPFLYAQRYVS
GYGLQSGQLSTLLYNTHPYRAFPVLLLDTVPWYLRLYVHTLTITSKGKENKPSYIHYQPA
QDRMQPHLLEMLIQLPASSITKVSIQFERALLKWTEYTPDPNHGFYVSPSVLSALVPSVV
AAKPGDWEESPLFNSLFPVSDSSSYFVRLYTEPLLVSLPTPDFSMPYNVVCLTCTVVAVC
YGSFYNLLTRTFQIEEPRKGGLVKRLANLIRRARGVPPL
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcccgtgaggattttcctgctggtgctgctgcttctgggaccgggcggctgg
ggccgggcggagcccccacgcgacagcctgcgagaggagctagtcatcaccccgctgcct
tcaggggacgtagccgccacattccagttccgcacgcgctgggattcggagctgcagcgg
gaaggagtgtctcactataggctcttccccaaagccttggggcagttgatctccaagtat
tctctccgggaactacacctgtccttaacccaaggcttctggaggactcgatactggggg
acacccttcttgcaggccccatcaggggcagagctgtgggcttggttccaagacactgtc
accgatgtggatgagtcctggaaggagctcagtaacgtcctctcggggatcttctgcgcc
tctctcaacttcatcgactccaccaacacggtcacgcccaccgcctccttcaaacccctg
gggctggccaatggcacggaccactccttcctgcgctacgcggtgctgccacgagaggtc
gtctgcaccgagaacctcaccccatggaagaagctcttgccctgcagctccaaggcaggc
ctctcggtgctgctgaaggctgatcgcctgttccacacaagctaccactcccaggcagtg
catatccgccctgtttgcagaaatgcacgctgtaccagcgtctcctgggagctgaggcag
accctttctgttgtatttgatgccttcgtcactggacaggggaagaaggactggtccctc
ttccggatgttctcccgaactctcaccgagccctgccccttggcttcggagagccgagtc
tatgtggacgttaccagctacggccaggacaacgagacattggaggtgtacccgcccccc
cttaccacataccaagacgtcatcctgggcacccggaagacctatgcggtctacgacctg
ctggatgcagctgtggtcagcaactcacgcagcctcaacatccagctgaagtggaagagg
cccccagagaatgcagaggcccccccggtgcccttcctgtatgcccagcggtatgtgagc
ggctacgggcttcagagcgggcagctgagcacgctgctgtacaacacccacccataccgg
gccttccctgtgctgctgctggacaccgtgccctggtacctgcggctgtacgtgcacacg
ctcaccatcacgtccaagggcaaggagaacaaaccaagttacatccactaccagcctgcc
caggaccggatgcagccccacctcctggagatgctgattcagctgccggccagctccatc
accaaggtctccatccagtttgagcgggcactgcttaagtggaccgagtacaccccggac
cccaaccatggcttctatgtcagcccatctgtcctcagcgccctcgtgcccagtgtggtg
gcagccaaacccggggactgggaagagagccccctcttcaacagcctcttcccagtctct
gacagctctagctactttgtgcggctctacacggagccactgctggtgagcctccccacg
ccggacttcagtatgccctacaacgtcgtctgcctcacgtgcaccgtggtggctgtgtgc
tacggctccttctacaacctcctcacccgcaccttccagatcgaggagcccaggaagggc
ggcctggtgaagcggctggccaacctcatccggcgtgcccgaggtgtccccccactctga

DBGET integrated database retrieval system