KEGG   Bos indicus (zebu cattle): 109567510
Entry
109567510         CDS       T04792                                 

Gene name
CD40
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 5 isoform X1
  KO
K03160  tumor necrosis factor receptor superfamily member 5
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04064  NF-kappa B signaling pathway
biu04514  Cell adhesion molecules
biu04620  Toll-like receptor signaling pathway
biu04672  Intestinal immune network for IgA production
biu05144  Malaria
biu05145  Toxoplasmosis
biu05166  Human T-cell leukemia virus 1 infection
biu05169  Epstein-Barr virus infection
biu05202  Transcriptional misregulation in cancer
biu05310  Asthma
biu05320  Autoimmune thyroid disease
biu05322  Systemic lupus erythematosus
biu05330  Allograft rejection
biu05340  Primary immunodeficiency
biu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    109567510 (CD40)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109567510 (CD40)
   04514 Cell adhesion molecules
    109567510 (CD40)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109567510 (CD40)
   04672 Intestinal immune network for IgA production
    109567510 (CD40)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    109567510 (CD40)
  09163 Immune disease
   05310 Asthma
    109567510 (CD40)
   05322 Systemic lupus erythematosus
    109567510 (CD40)
   05320 Autoimmune thyroid disease
    109567510 (CD40)
   05330 Allograft rejection
    109567510 (CD40)
   05340 Primary immunodeficiency
    109567510 (CD40)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109567510 (CD40)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109567510 (CD40)
   05169 Epstein-Barr virus infection
    109567510 (CD40)
  09174 Infectious disease: parasitic
   05144 Malaria
    109567510 (CD40)
   05145 Toxoplasmosis
    109567510 (CD40)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:biu04050]
    109567510 (CD40)
   04090 CD molecules [BR:biu04090]
    109567510 (CD40)
Cytokine receptors [BR:biu04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   109567510 (CD40)
CD molecules [BR:biu04090]
 Proteins
  109567510 (CD40)
SSDB
Motif
Pfam: TNFR_c6 Ribosomal_S27
Other DBs
NCBI-GeneID: 109567510
NCBI-ProteinID: XP_019828064
Position
13
AA seq 284 aa
MVRLPLQCLFWGFFLTAVHSEPATACGEKQYPVNSLCCDLCPPGQKLVNDCTEVSKTECQ
SCGKGEFLSTWNREKYCHEHRYCNPNLGLRIQSEGTLNTDTTCVCVEGQHCTSHTCESCT
PHSLCLPGFGVKQIATGLLDTVCEPCPLGFFSNVSSAFEKCHRWTSCERKGLVEQHVGTN
KTDVVCGFQSRMRTLVVIPVTMGVLFAVLLVSACISESPGNITKKRQAKALHPTAERQDP
VETIDPEDFPGPHPPPPVQETLCWCQPVAQEDGKESRISVQERE
NT seq 855 nt   +upstreamnt  +downstreamnt
atggttcgtttgccactgcagtgtctcttctggggcttctttctgaccgccgtccactca
gaaccagccactgcttgtggagagaagcaatacccagtgaacagtctttgctgtgatttg
tgcccrccgggacagaaactggtgaacgactgcacagaggtcagcaaaacagaatgccag
tcctgcggtaaaggcgaattcttgtccacctggaacagagagaaatactgtcacgagcac
agatactgcaaccccaacctagggctccggatccagagcgagggcaccttgaatacagac
accacttgtgtatgtgtcgaaggccaacactgtaccagtcacacctgygaaagttgcacg
ccccacagcttgtgtctccctggcttcggggtcaagcagatcgctacagggcttttggat
accgtctgtgaaccctgcccgctcggcttcttctccaacgtgtcatctgcttttgaaaag
tgtcaccgttggacaagctgcgagagaaaaggcctggtggaacaacacgtggggacgaac
aagacagatgttgtctgcggtttccagagtcggatgaggaccctggtggtgatccccgtc
acgatgggagtcytgtttgctgtcctgytggtatctgcctgtatcagtgagtccccaggg
aacataaccaagaagcggcaggctaaggccctgcaccctacggctgaaaggcaggatccc
gtggagacgattgatccggaggattttcccggcccccacccgcctcctccggtgcaagag
accttatgctggtgtcagccggtcgcccaggaggacggcaaagagagccgcatctccgtg
caggagcgagaatga

DBGET integrated database retrieval system