KEGG   Bos indicus (zebu cattle): 109567924
Entry
109567924         CDS       T04792                                 

Gene name
ITGB1
Definition
(RefSeq) integrin beta-1 isoform X1
  KO
K05719  integrin beta 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04015  Rap1 signaling pathway
biu04145  Phagosome
biu04151  PI3K-Akt signaling pathway
biu04360  Axon guidance
biu04510  Focal adhesion
biu04512  ECM-receptor interaction
biu04514  Cell adhesion molecules
biu04530  Tight junction
biu04611  Platelet activation
biu04670  Leukocyte transendothelial migration
biu04810  Regulation of actin cytoskeleton
biu05100  Bacterial invasion of epithelial cells
biu05133  Pertussis
biu05135  Yersinia infection
biu05140  Leishmaniasis
biu05145  Toxoplasmosis
biu05165  Human papillomavirus infection
biu05200  Pathways in cancer
biu05205  Proteoglycans in cancer
biu05222  Small cell lung cancer
biu05410  Hypertrophic cardiomyopathy
biu05412  Arrhythmogenic right ventricular cardiomyopathy
biu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    109567924 (ITGB1)
   04151 PI3K-Akt signaling pathway
    109567924 (ITGB1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    109567924 (ITGB1)
   04514 Cell adhesion molecules
    109567924 (ITGB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109567924 (ITGB1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109567924 (ITGB1)
   04530 Tight junction
    109567924 (ITGB1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109567924 (ITGB1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109567924 (ITGB1)
   04670 Leukocyte transendothelial migration
    109567924 (ITGB1)
  09158 Development and regeneration
   04360 Axon guidance
    109567924 (ITGB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109567924 (ITGB1)
   05205 Proteoglycans in cancer
    109567924 (ITGB1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    109567924 (ITGB1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    109567924 (ITGB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    109567924 (ITGB1)
   05414 Dilated cardiomyopathy
    109567924 (ITGB1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    109567924 (ITGB1)
   05133 Pertussis
    109567924 (ITGB1)
   05100 Bacterial invasion of epithelial cells
    109567924 (ITGB1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    109567924 (ITGB1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109567924 (ITGB1)
   05140 Leishmaniasis
    109567924 (ITGB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:biu04131]
    109567924 (ITGB1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109567924 (ITGB1)
   04515 Cell adhesion molecules [BR:biu04515]
    109567924 (ITGB1)
   04090 CD molecules [BR:biu04090]
    109567924 (ITGB1)
Membrane trafficking [BR:biu04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    109567924 (ITGB1)
Exosome [BR:biu04147]
 Exosomal proteins
  Proteins found in most exosomes
   109567924 (ITGB1)
Cell adhesion molecules [BR:biu04515]
 Integrins
  Integrin beta subunits
   109567924 (ITGB1)
CD molecules [BR:biu04090]
 Proteins
  109567924 (ITGB1)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail I-EGF_1 PSI_integrin EGF_2
Other DBs
NCBI-GeneID: 109567924
NCBI-ProteinID: XP_019828564
Position
13
AA seq 801 aa
MNLQLIFWIGLISSVCCVFGQADENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPT
SARCDDLEALKKKGCHPNDIENPRGSKDIKKNKNVTNRSKGTAEKLQPEDITQIQPQQLV
LQLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDF
RIGFGSFVEKTVMPYISTTPAKLRNPCTNEQNCTSPFSYKNVLSLTDKGEVFNELVGKQR
ISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQ
CHLENDVYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTL
SANSSNVIQLIIDAYNSLSSEVILENSKLPEGVTINYKSYCKNGVNGTGENGRKCSNISI
GDEVQFEISITANKCPNKNSETIKIKPLGFTEEVEIILQFICECECQGEGIPGSPKCHDG
NGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRK
RDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTTSCM
AVNGQICNGRGVCECGACKCTDPKFQGPTCEMCQTCLGVCAEHKECVQCRAFXKGEKKDT
CAQECSHFNITKVENRDKLPQPGQVDPLSHCKEKDVDDCWFYFTYSVNGNNEATVHVVET
PECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTQEN
PIYKSPINNFKNPNYGRKAGL
NT seq 2406 nt   +upstreamnt  +downstreamnt
atgaatttacaactgattttctggatcggattgatcagttcagtttgctgtgtgtttggc
caagcagatgaaaacagatgtttgaaagcaaatgccaaatcatgtggggagtgtatacaa
gcagggccaaattgtggatggtgcacaaattcaacatttttacaagaaggtatgcctaca
tctgctcgatgtgatgatttagaagccttaaaaaagaagggctgtcatccaaatgacatt
gaaaatcctagaggctccaaagatataaagaaaaataaaaatgtaacgaatcgaagcaaa
ggaacagcagagaagctgcagccagaagatatcactcaaatccagccacagcagttggtt
ctgcagttacgatcaggggagccacagacattcacactaaaattcaagcgggctgaagac
tatcccattgatctctactacctcatggacctctcctattccatgaaagacgacttggag
aatgtgaaaagtctgggaacagatttgatgaatgaaatgaggaggatcacttcagacttc
cgaattgggtttggttctttygtggagaaaactgtgatgccttacattagcacaacacca
gctaaactcaggaacccttgcacaaatgaacagaactgcacgagcccatttagctacaaa
aatgtgctcagccttactgataaaggggaagtatttaatgaacttgttggtaagcagcgc
atatctggaaatttggattcaccagaaggtggctttgatgcaatcatgcaagtcgcagtt
tgtggatccctgattggttggaggaatgtgacacggctgctggtgttttccacggatgct
gggtttcacttcgctggagatgggaaacttggtggcatcgttttaccgaatgatggacag
tgtcacctggaaaatgatgtgtacacaatgagccattattacgattatccttctattgct
caccttgtccagaaactaagcgaaaataacattcagacgatttttgcagttactgaagaa
tttcagcctgtttacaaggaactgaaaaatttgatccctaagtcagcggtaggaacatta
tctgcaaattccagcaatgtgattcagttgatcatcgatgcgtacaattccctttcttca
gaagtcattttggaaaacagcaaattgccggaaggagtaacaataaattacaagtcttac
tgcaagaatggggtgaatggaacaggggaaaatgggagaaaatgctctaatatttccatt
ggggatgaggttcagtttgaaattagcataactgcaaataaatgtccaaataagaactct
gaaaccattaaaattaagcctctgggcttcactgaggaagtggagattatccttcagttc
atctgtgaatgtgagtgccagggtgaaggcatcccaggaagccccaagtgccacgacggc
aaygggaccttcgagtgtggggcctgcaggtgcaacgagggacgtgtcgggagacactgt
gaatgtagcacagatgaggtgaacagcgaagacatggaygcctactgcaggaaagaaaac
agttcagaaatctgtagcaacaatggagagtgtgtctgtggacagtgtgtgtgtaggaag
agggacaatacaaatgaaatttattctggcaaattctgcgagtgtgataatttcaactgt
gatagatccaatggcttaatatgtggaggaaatggtgtttgcaagtgtcgagtgtgtgag
tgcaaccctaactacaccggcagcgcctgtgactgttctctggataccacttcctgcatg
gcygtgaatggacagatctgcaatggccgcggcgtctgcgagtgtggtgcctgtaagtgt
acagaccccaagttccaagggccaacctgtgagatgtgtcagacctgccttggagtctgt
gctgagcataaagaatgtgttcagtgccgagccttcartaaaggagagaagaaagacaca
tgtgctcaggaatgttcacatttcaacattaccaaggttgaaaatcgggacaaattgccc
cagccaggccaggtggatcccttgtcccactgtaaggagaaggacgttgacgactgctgg
ttctacttcacatactccgtgaatgggaacaatgaggccactgttcatgttgtagagact
ccagagtgccccactggtccagacattattccaattgtagcaggtgtrgttgctggaatt
gttcttattggccttgcattgctgctgatttggaagcttttaatgatcattcatgacaga
agggaatttgccaaatttgagaaggaaaaaatgaatgccaaatgggacacgcaagaaaat
ccgatttacaagagtcctattaataatttcaagaacccaaactatggacgtaaagctggt
ctctaa

DBGET integrated database retrieval system