KEGG   Bos indicus (zebu cattle): 109568053
Entry
109568053         CDS       T04792                                 

Gene name
THBD
Definition
(RefSeq) thrombomodulin
  KO
K03907  thrombomodulin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
biu04933  AGE-RAGE signaling pathway in diabetic complications
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109568053 (THBD)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109568053 (THBD)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    109568053 (THBD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109568053 (THBD)
   00535 Proteoglycans [BR:biu00535]
    109568053 (THBD)
   04091 Lectins [BR:biu04091]
    109568053 (THBD)
CD molecules [BR:biu04090]
 Proteins
  109568053 (THBD)
Proteoglycans [BR:biu00535]
 Cell surface proteoglycans
  Others
   109568053 (THBD)
Lectins [BR:biu04091]
 C-Type lectins
  Group 14: Thrombomodulin
   109568053 (THBD)
SSDB
Motif
Pfam: Tme5_EGF_like cEGF FXa_inhibition EGF_CA Lectin_C EGF TIL hEGF
Other DBs
NCBI-GeneID: 109568053
NCBI-ProteinID: XP_019828825
Position
13
AA seq 578 aa
MLRVLLLGVLAPAGLGLPAPPEPQPLGGQCVDLDCFAVFRGPATFLAASRVCERLQGHLM
TVRSSVAEDVISLLLSGDGPRLWIGLQRPPGCDDPEHSGPLRGFQWVTGDNRTSFSRWAR
PHDDGARLCGPLCVAVSAAAGALAPGEPAWEERPCDAEADGFLCEFHFAASCRPLAVDPG
ATAAAGLSITYGTPFGARGADFQALPLGSTAAVAPLGVELXXAAPPGETEGRWSREAPGA
WACGVERGGCQHECKGSAGASNCLCPADAALQADGRSCGLPAEHPCHQLCEHFCHLHGLG
NYTCICEAGYQLAADQHRCEDVDDCAQLPSPCPQRCVNTEGGFQCHCDTGYELVDGECVD
PVDPCFDNNCEYQCQPVGRSEHKCICAEGFAPVPGAPHKCQMFCNQTSCPADCDPHYPTI
CRCPEGYIIDEGSTCTDINECDTNICXGQCHNLPGTYECICGPDSALSGQIGIDCDSTQV
NEERGTPEDYGGSGEPPVSPTPGATARPSPAPAGPLHSGVLVGISIASLSLVVALLALLC
HLRKKQGASRGELEYKCGVPAKELMLQQVKTERTPQKL
NT seq 1737 nt   +upstreamnt  +downstreamnt
atgctgcgcgtcctgctcctcggcgtgctggcccccgccggcctggggctcccggcaccc
cctgaaccgcagcccctcggcggccagtgcgtcgatcttgactgcttcgccgtcttccgg
ggccctgcgactttcctcgccgccagccgagtctgcgagcgcctgcagggccacctgatg
actgtgcgctcctcggtggcggaagatgtcatctccctgctcctgagcggcgacggcccg
cgcctctggatcggtctgcagcgcccgccaggctgcgacgacccagagcactccgggccc
ttgcgcggcttccagtgggtgacgggcgacaaccgcaccagcttcagcaggtgggcgcgg
cctcacgacgacggggcgcgcctctgcggtccgctgtgcgtcgccgtctcggcggctgcc
ggggcgctggcaccgggagagcccgcctgggaggagcggccgtgcgacgcggaggcagac
ggcttcctctgcgagttccacttcgccgcctcctgcaggccgctggctgtggaccctggc
gccacggcggccgcgggcctctcgatcacctatggcacccctttcggagcccgcggcgcg
gactttcaggcgctcccgctgggcagtacggccgcggtggcgcccctcggggtggagctg
gnnnncgcggcgccgccaggggagaccgaggggcgctggagcagggaagccccgggcgcc
tgggcctgcggcgtcgagcgcggcggctgccagcacgagtgcaaggggagtgctggggct
tcgaactgcttgtgtccggcggacgccgccctgcaggcggacggacgctcctgcgggctg
ccggccgagcacccgtgccaccaactctgcgagcacttctgccacctccacgggctcggc
aactacacgtgcatctgcgaggcaggctaccagctggccgccgaccagcaccgatgtgag
gacgtggacgactgcgcgcagttgcccagtccgtgcccgcaacgctgcgtcaacacggag
ggcggcttccagtgccactgcgacactggctatgagttggtggacggcgagtgcgtggac
cccgtggacccgtgctttgacaataactgcgagtaccagtgccaaccggtgggccggtcc
gaacacaagtgcatctgcgccgagggcttcgcgccagtccccggtgccccgcacaagtgc
cagatgttctgcaaccagacttcgtgcccggctgactgcgatcctcactacccgaccatc
tgccggtgccccgaaggctatatcatagacgagggctccacgtgcacggacatcaacgag
tgtgacaccaacatctgccstggccagtgccacaacctccccggcacttacgagtgcatc
tgcgggcctgactcggccctctctggccagattggcatcgactgtgactccacccaggtg
aatgaggagcggggcaccccggaggactatggcggctctggggagcccccggtcagcccg
actccgggcgccaccgcacgcccctcgccggcacctgctggtcccctgcactcgggcgtg
ctcgtgggcatctccattgcaagcctgtctctggtggtggcgcttctggccctcctttgc
cacctgcgcaagaagcagggcgcctcgcggggggagctggagtacaagtgcggggtcccc
gccaaggagctgatgctgcagcaggtgaagactgagcggacacctcagaaactctga

DBGET integrated database retrieval system