KEGG   Bos indicus (zebu cattle): 109568754
Entry
109568754         CDS       T04792                                 

Gene name
ALCAM
Definition
(RefSeq) CD166 antigen isoform X1
  KO
K06547  activated leukocyte cell adhesion molecule
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109568754 (ALCAM)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:biu04515]
    109568754 (ALCAM)
   04090 CD molecules [BR:biu04090]
    109568754 (ALCAM)
Cell adhesion molecules [BR:biu04515]
 Immunoglobulin superfamily
  ALCAM
   109568754 (ALCAM)
CD molecules [BR:biu04090]
 Proteins
  109568754 (ALCAM)
SSDB
Motif
Pfam: Ig_3 C2-set_2 Ig_2 I-set ig C1-set V-set Amnionless CD34_antigen Podoplanin FixQ PepSY_TM
Other DBs
NCBI-GeneID: 109568754
NCBI-ProteinID: XP_019829736
Position
1
AA seq 583 aa
MASKAAPSCRLVFCLLISATVLRPGLGWYTVNSAYGDTIIMPCRVDVPQNLMFGKWKYEK
PDGSPVFIAFRSSTKKSVQYDDVPEYKDRLNLSENYTLSISNAKISDEKRFVCMLVTEDD
VFEAPTVVKVFKQPSKPEIVSKAPFLETDKLKKLGECISKDSYPDGNITWYRNGKVLQPL
EGAVVIIFRKQMDSVTQLYTMTSSLEYKTTKADIQMPFTCSVTYYGPSGQKTVYSEQAVF
DIYYPTEQVTIQVLPSKNAIKEGDNITLKCLGNGNPPPEEFLFYLPGQPEGIRSSNTYTL
TDVKRNATGDYKCSLVDKKSMIASAAITVHYLDLSLNPSGEVTKQIGDALPVSCTISASR
NATVVWMKDNVKLRSSPSFSSLHYQDAGNYVCETALQEVEGLKKRESLTLIVEGKPQIKM
TKKTDPSGLSKTIICHVEGFPKPAIQWTITGSGSVINQTEESPYINGRYYSKIIISPEEN
VTLTCTAENQLERTVNSLNVSAISIPEHDEADEISDENKEKVNDQAKLIVGIVVGLLLAA
LVAGVVYWLYMKKSKTASKHVNKDLGNMEENKKLEENNHKTEA
NT seq 1752 nt   +upstreamnt  +downstreamnt
atggcttcgaaggcggccccctcctgccgtctggtcttctgcctcttgatctccgctact
gtccttaggccaggtcttggatggtatactgtaaactcagcatatggagataccattatc
atgccttgccgagttgatgtacctcagaatctcatgtttggcaaatggaaatatgaaaag
cccgatggctccccagtatttattgccttcaggtcctctacaaagaaaagtgtgcagtac
gacgatgtaccagaatacaaagacagattgaacctctcagaaaactatactctctctatc
agtaatgcaaagatcagtgatgaaaagagatttgtgtgcatgctagtaactgaggacgac
gtgtttgaggctcctacagtagtcaaggtgttcaagcaaccatckaaacctgaaattgta
agcaaagccccatttcttgagacagacaagcttaaaaagttgggtgagtgcatttcaaaa
gacagttatccagatggcaacatcacatggtacaggaatggaaaagttctgcaacctctt
gaaggagcggtggtcataatttttagaaagcaaatggactcagtaactcagctctatacc
atgacttcatccctggagtacaagacaaccaaggctgacatacaaatgccattcacctgc
tctgtgacatattatggaccatctggccagaaaacagtttactctgaacaagcagttttt
gatatttactatcctacagagcaggtgacaatacaagtgctgccatcaaaaaatgccatc
aaagaaggggacaatatcactcttaaatgcttgggaaatggtaaccctcctcctgaggag
tttttgttttacttaccaggacagcctgaaggaattagaagttcaaatacttacacactg
acagatgtgaaacgcaatgcaacaggagactataaatgctccctggtagacaaaaaaagc
atgattgcttcagcagccatcacagttcactatttggatttgtccttaaacccaagyggg
gaggtgactaagcagattggcgatgctctgcctgtgtcatgcacaatatctgccagtagg
aatgcaactgtggtgtggatgaaagataacgtcaagcttcgatctagcccatcattttct
agtcttcattatcaggatgctggaaactatgtctgtgaaacagctctgcaagaggttgaa
ggattaaagaaaagagagtcgttgactctaattgtagaaggaaaacctcaaatcaaaatg
acaaagaaaactgatcccagtggactgtctaaaacaataatctgccatgtggaaggtttt
ccgaagccagctatacagtggacaattactggcagtggaagtgtcataaaccaaacmgag
gaatctccgtatatcaatggcaggtattatagtaaaattatcatttcccctgaagagaat
gttacattaacttgcacagcagaaaaccagctggagagaacagtaaactccttgaatgtc
tctgctataagtattccagaacacgatgaggcagacgagataagtgatgaaaacaaagaa
aaggttaatgaccaggcaaaactaattgtgggaattgttgttggtctcctcctcgctgcc
ctagttgctggtgtcgtctattggctatacatgaagaaatcaaagactgcatcaaaacat
gtaaacaaggaccttggtaatatggaagaaaacaaaaagttagaagaaaacaatcacaaa
acagaagcctaa

DBGET integrated database retrieval system