KEGG   Bos indicus (zebu cattle): 109568807
Entry
109568807         CDS       T04792                                 

Gene name
NECTIN1
Definition
(RefSeq) LOW QUALITY PROTEIN: nectin-1
  KO
K06081  poliovirus receptor-related protein 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu04520  Adherens junction
biu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109568807 (NECTIN1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    109568807 (NECTIN1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109568807 (NECTIN1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:biu04515]
    109568807 (NECTIN1)
   04090 CD molecules [BR:biu04090]
    109568807 (NECTIN1)
Cell adhesion molecules [BR:biu04515]
 Immunoglobulin superfamily
  Nectin family
   109568807 (NECTIN1)
CD molecules [BR:biu04090]
 Proteins
  109568807 (NECTIN1)
SSDB
Motif
Pfam: C2-set_2 V-set Ig_3 Ig_2 ig I-set
Other DBs
NCBI-GeneID: 109568807
NCBI-ProteinID: XP_019829750
Position
15
AA seq 456 aa
MARMGLAGAAGRWWGLALGLTAFFLPGAQAQMVQVNDSMYGFIGTDVVLHCSFANPLPGV
KITQVTWQKATNGSKQNVAIYNPAMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEG
VYICEFATFPAGNRESQLNLTVMAKPTNWIEGTHAVLRARKGQDEKVLVATCTSANGKPP
SVVSWETRLKGEAEYQEIRNPNGTVTVISRYRLVPSREAHRQSLACIVNYHMDRFWESLT
LNVQYEPEVTIEGFDGNWYLQRMDVKLTCKADANPPATEYHWTTLNGSLPKGVEAQNRTL
FFRGPINYSLAGTYVCEATNPIGTRSAQVEVNITEKPLPRGGPGIMARLLGCAVAVALIL
SVASTVFLYHWQQKNRLEMDGGGTALPLSQEPEPSPSRQSHLALENIQILGLELEKQQLQ
QEEDEXQKLPPQPPYYDLGXSPSYHPLVRTPEPXGC
NT seq 1371 nt   +upstreamnt  +downstreamnt
atggctcggatggggcttgcgggcgccgctggacgctggtggggactcgctctcggcttg
accgccttcttcctcccaggcgcccaggcccagatggtccaggtgaacgactccatgtac
ggtttcatcggcacggacgtggtgcttcactgcagcttcgccaacccgctgccgggcgtg
aagatcacccaggtcacatggcagaaagccaccaatggctccaagcagaacgtggccatc
tacaacccagccatgggcgtctcggtgctggccccataccgcgagcgcgtggagttcctg
cggccctccttcacagatggtaccatccgcctctcccgcctggagctggaggacgagggc
gtctacatctgcgagtttgccaccttccctgcgggcaacagagagagccagctcaatctc
actgtgatggccaaacccaccaactggatagagggcacccatgcagtgcttcgagccagg
aaggggcaggatgaaaaggtcctggtggccacctgcacgtcagccaatgggaagcctccc
agtgtggtgtcctgggaaacgcggctgaagggcgaggcggagtaccaggagatccggaac
cccaacggcacggtgaccgtcatcagccgctaccgcctggtgcccagccgagaagcccac
cggcagtccctggcctgcatagtcaactaccacatggaccgcttctgggaaagcctcacc
ctcaacgtgcagtacgagcccgaggtgaccatcgaggggtttgatggcaactggtacctg
cagcggatggatgtgaagctcacgtgcaaagccgatgccaaccccccagccactgagtac
cactggaccacgctgaatggctccctccccaagggcgtggaggcccagaacagaactctc
ttcttcaggggacccatcaactacagcctggcaggaacctatgtctgtgaggccaccaac
cccatcggcacccgctcagcccaggtggaggtcaacatcacagaaaagcccctcccccgg
gggggcccaggaattatggcgaggctcctggggtgtgccgtggccgtggccctcatcctc
agtgtggcttccactgtctttctgtatcactggcagcagaagaaccggctggagatggat
gggggcgggactgccctgcctctctcccaggagccagaaccttctcccagcaggcagagc
caccttgcacttgagaacatccagattcttggcctagagctggagaagcagcagctacag
caggaagaggatgaacygcagaagctgcccccacagcccccctactacgatctggggrcc
tccccctcctaccaccccttggtaaggacccctgagccttraggatgctga

DBGET integrated database retrieval system