KEGG   Bos indicus (zebu cattle): 109569493
Entry
109569493         CDS       T04792                                 

Gene name
CFLAR
Definition
(RefSeq) CASP8 and FADD-like apoptosis regulator isoform X1
  KO
K04724  CASP8 and FADD-like apoptosis regulator
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04064  NF-kappa B signaling pathway
biu04140  Autophagy - animal
biu04210  Apoptosis
biu04217  Necroptosis
biu04668  TNF signaling pathway
biu05142  Chagas disease
biu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    109569493 (CFLAR)
   04668 TNF signaling pathway
    109569493 (CFLAR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109569493 (CFLAR)
  09143 Cell growth and death
   04210 Apoptosis
    109569493 (CFLAR)
   04217 Necroptosis
    109569493 (CFLAR)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    109569493 (CFLAR)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    109569493 (CFLAR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109569493 (CFLAR)
Peptidases and inhibitors [BR:biu01002]
 Cysteine peptidases
  Family C14: caspase family
   109569493 (CFLAR)
SSDB
Motif
Pfam: DED Peptidase_C14
Other DBs
NCBI-GeneID: 109569493
NCBI-ProteinID: XP_019830416
Position
2
AA seq 511 aa
MKSVASWPSIDWTRLFFLPFLGMTLYRMSAEVIHQVEEALDEEEKDTLLFLCRDVAADVV
PLNVRDLLDILRERGKLSSVSLAELLYRVRRFDLLKRVLNMDTPTVEALLRKHPHLISDY
RVLMMEIGEDLDKSDVSSLMFLMRDYTGRSKIAKDKSFLDLVVELEKLNLVAPDQLNLLE
ESLRNINRIDLKTKIQKYKQSAQGVETNYVNARQASLPNLSVKDPSYNLRLQNGRSKEQR
LMMGPPDIQREPVKRPIQESGAFLPQHIVEERYKMQSKPLGICLIIDCIGNDTDILRDTF
TSLGYEVKHFLYLTVKDITNILRQVAQMPQHQDSDSFACILVSRGGSQSVFGVDQTHSGV
PLDHIRRMFMADTCPSLSGKPKLFFIQSYVKSEGQLEDSSFLEVDGPSVKSADSKARQPG
PYQDLIHREADFFWSLCKADVSLLEGPSSSPSLYLKCLSQKLWKERKHSLLELHTELNRL
VYDWNSKVSAKERYYVWLQHTLRKNLFLSHK
NT seq 1536 nt   +upstreamnt  +downstreamnt
atgaaatcagtagcttcatggccttctattgactggactagacttttcttcctgccattc
cttggaatgacactgtacaggatgtctgctgaagtcatccatcaggtagaagaagcactt
gatgaagaggagaaggatacactcctttttttgtgccgagatgttgctgcagatgtggtt
ccactgaatgtcagggatcttctggatattttaagagagagaggaaagctgtcttctgtg
agcttggctgagctgctctacagagtgaggcggtttgacttgctcaagagggtcttgaat
atggataccccgacagtggaggccctcctgcgcaagcacccacatctgatttcagactat
agggtgctgatgatggagattggtgaggatttggataaatctgacgtgtcctcattaatg
ttcctcatgagagattatacgggtcgaagcaagatagccaaggataagagtttcttggat
cttgtggttgaattggagaagctaaatctggttgctccagatcaactgaatttattagaa
gaaagcctaaggaacatcaacaggatagacctgaagacaaaaatccagaaatacaagcag
tcagctcaaggagtggaaacaaattatgtaaatgctcgccaggcatctctgccaaacttg
agtgttaaagatccttcatataacctaaggctccagaatggcaggagtaaagaacaaagg
cttatgatgggaccacctgacattcaaagagaaccagtgaagagacccattcaggaatca
ggagcatttttgcctcagcacatagtagaagagagatataagatgcagagcaagcccctg
ggaatctgcctgataattgactgcattggcaatgacacagacattcttcgggacaccttc
acttccctgggctatgaagtcaagcatttcttatatctcactgtgaaagatataaccaac
attctacgccaagttgcccagatgccccagcaccaagactctgacagctttgcgtgtatc
ctggtgagccgagggggctcccagagcgtgtttggcgtggatcagactcactctggggtc
cctttggatcatatcagaagaatgttcatggcagacacgtgcccctctctctcagggaag
ccaaagctcttttttattcagagctatgtgaaatcagagggccagctggaggacagcagc
ttcctggaggtggacgggccgtcagtgaaaagtgcagactccaaggccagacagcctggg
ccctaccaagatttgattcaccgagaagctgacttcttctggagcctgtgcaaagcagat
gtgtccctgctggaggggccctccagctcaccctcattgtacctgaagtgcctctcccag
aaactgtggaaagaaagaaagcactcgctcctggaactccacactgaactcaaccgcctg
gtgtatgattggaacagcaaagtgtctgctaaggagcgatactatgtctggctgcagcac
actttgagaaagaatctcttcctctctcacaaataa

DBGET integrated database retrieval system