KEGG   Bos indicus (zebu cattle): 109569521
Entry
109569521         CDS       T04792                                 

Gene name
CASP8
Definition
(RefSeq) caspase-8
  KO
K04398  caspase 8 [EC:3.4.22.61]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01524  Platinum drug resistance
biu04115  p53 signaling pathway
biu04210  Apoptosis
biu04215  Apoptosis - multiple species
biu04217  Necroptosis
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04625  C-type lectin receptor signaling pathway
biu04657  IL-17 signaling pathway
biu04668  TNF signaling pathway
biu04932  Non-alcoholic fatty liver disease
biu05010  Alzheimer disease
biu05016  Huntington disease
biu05132  Salmonella infection
biu05134  Legionellosis
biu05142  Chagas disease
biu05145  Toxoplasmosis
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05200  Pathways in cancer
biu05203  Viral carcinogenesis
biu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    109569521 (CASP8)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109569521 (CASP8)
   04215 Apoptosis - multiple species
    109569521 (CASP8)
   04217 Necroptosis
    109569521 (CASP8)
   04115 p53 signaling pathway
    109569521 (CASP8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109569521 (CASP8)
   04621 NOD-like receptor signaling pathway
    109569521 (CASP8)
   04622 RIG-I-like receptor signaling pathway
    109569521 (CASP8)
   04625 C-type lectin receptor signaling pathway
    109569521 (CASP8)
   04657 IL-17 signaling pathway
    109569521 (CASP8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109569521 (CASP8)
   05203 Viral carcinogenesis
    109569521 (CASP8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109569521 (CASP8)
   05016 Huntington disease
    109569521 (CASP8)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109569521 (CASP8)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    109569521 (CASP8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109569521 (CASP8)
   05134 Legionellosis
    109569521 (CASP8)
   05152 Tuberculosis
    109569521 (CASP8)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109569521 (CASP8)
   05162 Measles
    109569521 (CASP8)
   05164 Influenza A
    109569521 (CASP8)
   05161 Hepatitis B
    109569521 (CASP8)
   05160 Hepatitis C
    109569521 (CASP8)
   05168 Herpes simplex virus 1 infection
    109569521 (CASP8)
   05163 Human cytomegalovirus infection
    109569521 (CASP8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109569521 (CASP8)
   05169 Epstein-Barr virus infection
    109569521 (CASP8)
   05165 Human papillomavirus infection
    109569521 (CASP8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109569521 (CASP8)
   05142 Chagas disease
    109569521 (CASP8)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    109569521 (CASP8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109569521 (CASP8)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.61  caspase-8
     109569521 (CASP8)
Peptidases and inhibitors [BR:biu01002]
 Cysteine peptidases
  Family C14: caspase family
   109569521 (CASP8)
SSDB
Motif
Pfam: Peptidase_C14 DED
Other DBs
NCBI-GeneID: 109569521
NCBI-ProteinID: XP_019830504
Position
2
AA seq 485 aa
MALTQCLYNIGEQLGSDDLAALKFLSRDHIPYRKQEPIKDALMLFQRLQEKRMLEENNLS
FLKELLFRVNRLDLLLNYLYTSEEEMKRELQIPGRAQISAYRILLFQISEDVNKVELKDF
KFFLSQEIAKCKLDDDMTLLDIFVEMEKRTILGEENLDTLKRICEQVNKSLLKKIYDYEE
LRKERRMSLERDPYAFSNDMSQSLPEEGYSKMPAMSDSPEQDSELQTSDTVYRMTSKPRG
YCLIFNNYDFSIARKQVPELHDLKDRTGTDFDADALDKTFRELHFEIVHYKDLTAKGICE
VLESYQKKDHKNKDCFICCILTHGNKGIIYGSDGQEASIYELTSYFTGLKCPSLIGKPKI
FFIQACQGDKYQKGVAVETDSEQMEAYLEVDSSPQKRYIPDEADFLLGMATVKNYVSYRN
IWNGAWYIQSLCQNLRERCPRGEDILTILTKVNFEVSKLDDKQRMAKQMPQPTFTLRKKL
FFPLN
NT seq 1458 nt   +upstreamnt  +downstreamnt
atggcgctcacccaatgtctctataatattggggagcagctgggcagtgacgacctggct
gccctcaagttcctaagccgggaccacatcccatataggaagcaggaacccatcaaggat
gccttgatgctattccagaggctccaagaaaagagaatgttggaggaaaacaatctgtcc
ttcttgaaggagctgcttttccgagtgaatagactggatctgctgcttaactacttgtat
accagcgaggaggagatgaagagggagcttcagatacccggcagggcccagatctctgcc
tacaggattctgcttttccagatttcagaagatgtgaacaaagtagaattgaaggacttt
aagttttttttgagccaggagattgccaaatgtaagctggatgatgacatgactttgctt
gatattttcgtggagatggagaagaggaccatcctaggggaagagaacttggacaccctg
aaaagaatctgtgagcaggtcaacaagagcttgctgaagaaaatctatgattatgaagaa
ttaagaaaagagagaagaatgagccttgaaagagatccatatgcattttcaaatgatatg
tcacaatcgcttccagaggagggctactctaagatgccggccatgtcagactctccagaa
caggacagtgagttgcagacatctgacacagtttaccgaatgacaagcaaacctcgggga
tactgtttgatctttaacaattatgattttagcatagcacggaagcaggtgcctgaactt
cacgaccttaaggataggactggaacagactttgatgcagacgctttggataagaccttt
cgtgaacttcattttgagatagtgcactacaaagacctaacagcaaagggaatctgtgag
gttctagaatcctaccagaagaaggaccacaaaaacaaagactgcttcatctgctgcatc
ctcacccacggaaacaagggcatcatctatggctcygatgggcaagaagcctccatctat
gagctgacctcttacttcactggcttaaagtgcccttcccttattggcaaacccaaaatc
ttttttattcaggcttgccaaggggacaagtaccagaaaggtgtagcygttgagaccgac
tcagaacagatggaagcctatttagaggtggactcatcacctcagaagagatatatccca
gatgaggctgactttctgctggggatggccactgtgaaaaactatgtttcctaccgaaac
atctggaatggggcctggtatatccagtcactttgccagaatctgagagaaagatgtcct
aggggtgaagacattctgaccatcctaaccaaggtgaacttcgaagtaagcaaactggat
gacaagcaacgtatggccaaacagatgccacaacctactttcacactgcgaaaaaaactc
ttctttcctcttaattga

DBGET integrated database retrieval system