KEGG   Bos indicus (zebu cattle): 109569554
Entry
109569554         CDS       T04792                                 

Gene name
F2
Definition
(RefSeq) prothrombin isoform X1
  KO
K01313  coagulation factor II (thrombin) [EC:3.4.21.5]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04072  Phospholipase D signaling pathway
biu04080  Neuroactive ligand-receptor interaction
biu04610  Complement and coagulation cascades
biu04611  Platelet activation
biu04810  Regulation of actin cytoskeleton
biu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    109569554 (F2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109569554 (F2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109569554 (F2)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109569554 (F2)
   04611 Platelet activation
    109569554 (F2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109569554 (F2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109569554 (F2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109569554 (F2)
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109569554 (F2)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.5  thrombin
     109569554 (F2)
Peptidases and inhibitors [BR:biu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   109569554 (F2)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   109569554 (F2)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Haparin
  Coagulation and fibrinolysis
   109569554 (F2)
SSDB
Motif
Pfam: Trypsin Kringle Thrombin_light Gla Trypsin_2 DUF1986
Other DBs
NCBI-GeneID: 109569554
NCBI-ProteinID: XP_019830584
Position
15
AA seq 631 aa
MARVRGPRLPGCLALAALFSLVHSQHVFLAHQQASSLLQRARRANKGFLEEVRKGNLERE
CLEEPCSREEAFEALESLSATDAFWAKYTACESARNPREKLNECLEGNCAEGVGMNYRGN
VSVTRSGIECQLWRSRYPHKPEINSTTHPGADLRENFCRNPDGSITGPWCYTTSPTLRRE
ECSVPVCGQDRVTVEVIPRSGGSTTSQSPLLETCVPDRGREYRGRLAVTTXGSRCLAWSS
EQAKALSKDQDFNPAVPLAENFCRNPDGDEEGAWCYVADQPGDFEYCDLNYCEEPVDGDL
GDRLGEDPDPDAAIEGRTSEDHFQPFFNEKTFGAGEADCGLRPLFEKKQVQDQTEKELFE
SYIEGRIVEGQDAEVGLSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNF
TVDDLLVRIGKHSRTRCGGAPRYERKVEKISMLDKIYIHPRYNWKENLDRDIALLKLKRP
IELSDYIHPVCLPDKQTAAKLLHAGFKGRVTGWGNRRETWTTSVAEVQPSVLQVVNLPLV
ERPVCKASTRIRITDNMXCAGYKPGEGKRGDACEGDSGGPFVMKSPYNNRWYQMGIVSWG
EGCDRDGKYGFYTHVFRLKKWIQKVIDRLGS
NT seq 1896 nt   +upstreamnt  +downstreamnt
atggcgcgcgtccgaggcccgcggctgcctggctgcctggccctggctgccctgttcagc
ctcgtgcacagccagcatgtgttcctggcccatcagcaagcatcctcgctgctccagagg
gcccgccgtgccaacaagggcttcctggaggaggtgcggaagggcaacctggagcgagag
tgcctggaggagccatgcagccgcgaggaggccttcgaggccctggagtctctcagtgcc
acggatgcgttctgggccaagtacacagcttgtgagtcagcgagaaatcctcgagaaaag
ctcaatgaatgtctggaaggaaactgcgctgaaggtgtggggatgaactaccgagggaac
gtgagcgtcacccggtcaggcatcgagtgccagctgtggagaagtcgctacccacataag
ccagaaatcaactctaccacccacccgggggctgacctgcgggagaatttttgccgcaac
ccggatggcagcattactgggccctggtgctacaccacatccccgactctgcggagagaa
gagtgcagcgtcccggtgtgcggccaggaccgagtcacagtggaggtgatcccccggtcg
ggaggctccaccaccagtcagtcgcctctactggaaacatgcgtcccggaccgcggccgg
gagtaccgggggcggctggcggtgaccacamrcgggtcccgctgccttgcctggagcagc
gagcaggccaaggccctgagcaaggaccaggacttcaacccggccgtgcccctggcggag
aacttctgccgcaacccagacggggacgaggagggcgcctggtgctacgtggccgaccag
cctggcgactttgagtattgtgacctgaactactgcgaggagccggtggatggagacctg
ggagacaggctgggtgaggacccggacccggacgcggccatcgagggacgcacgtctgag
gaccatttccagcccttcttcaacgagaagacctttggcgccggggaggccgactgtggc
ctgcgacccctgttcgagaagaagcaggtgcaggaccaaacggagaaggagcttttcgag
tcctacatcgaggggcgcatcgtggagggtcaggacgcggaggttggcctctcgccctgg
caggtgatgctctttcgtaagagtccccaggagctgctctgtggggccagcctcatcagt
gaccgctgggtcctcacggctgcccactgtctcctgtacccgccttgggacaagaacttc
accgtrgatgacctgctggtgcgcatcggcaagcactcccgcaccaggtgcggaggggcc
cccaggtatgagcggaaggttgaaaagatctccatgctggacaagatctacatccacccc
aggtacaactggaaggagaatctggaccgggacatcgccctgctgaagctcaagaggccc
atcgagttatccgactacatccaccccgtgtgcctgcccgacaagcagacagcagccaag
ctgctccacgctgggttcaaagggcgggtgacgggctggggcaaccggagggagacgtgg
accaccagcgtggccgaggtgcagcccagcgtcctccaggtggtcaacctgcctctcgtg
gagcggcccgtgtgcaaggcctccacccggatccgcatcaccgacaacatgttmtgtgcc
ggttacaagcctggtgaaggcaaacgaggggacgcttgtgagggcgacagcgggggaccc
ttcgtcatgaagagcccctataacaaccgctggtatcaaatgggcatcgtctcatggggt
gaaggctgtgacagggatggaaaatatggcttctacacacacgtcttccgcctgaagaag
tggatacagaargtcattgatcggttaggaagttag

DBGET integrated database retrieval system