KEGG   Bos indicus (zebu cattle): 109569654
Entry
109569654         CDS       T04792                                 

Gene name
CADM1
Definition
(RefSeq) cell adhesion molecule 1 isoform X1
  KO
K06781  cell adhesion molecule 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109569654 (CADM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:biu04515]
    109569654 (CADM1)
Cell adhesion molecules [BR:biu04515]
 Immunoglobulin superfamily
  Necl family
   109569654 (CADM1)
SSDB
Motif
Pfam: Ig_3 Ig_2 I-set ig V-set C2-set_2 Ig_4 Mucin Ig_C17orf99 C1-set Syndecan
Other DBs
NCBI-GeneID: 109569654
NCBI-ProteinID: XP_019830814
Position
15
AA seq 473 aa
MASAVLPSGPQCAAAAAAAAAAAPPGLRLRLLLLLLSXAALIPTGDGQNLFTKDVTVIEG
EVATISCQVNKSDDSVIQLLNPNRQTIYFRDFRPLKDSRFQLLNFSSSELKVSLTNVSIS
DEGRYFCQLYTDPPQESYTTITVLVPPRNLMIDIQKDTAVEGEEIEVNCTAMASKPATTI
RWFKGSKELKGKSEVEEWSDMYTVTSQLMLKVHKEDDGVPVICQVEHPAVTGNLQTQRYL
EVQYKPQVHIQMTYPLQGLTREGDALELTCEAIGKPQPVMVTWVRVDDEMPQHAVLSGPN
LFINNLNKTDNGTYRCEASNIVGKAHSDYMLYVYDPPTTIPPPTTTSTTTTTTTTILTII
TDTTATTEPAVHGLTQLPNSAEELDSEDLSDSRAGEEGAIRAVDHAVIGGVVAVVVFAML
CLLIILGRYFARHKGTYFTHEAKGADDAADADTAIINAEGGQNNSEEKKEYFI
NT seq 1422 nt   +upstreamnt  +downstreamnt
atggcgagtgctgtgctgccgagcggaccccagtgtgcggcggcggcggcggcggcggcg
gcggcggcgcctcccgggctccggcttcggcttctgctgttgctcctttctnccgcggca
ctgatccccacaggtgatggacagaatttgtttacgaaagacgtgacagtgattgaagga
gaagttgccaccatcagctgccaagtcaataagagtgacgactctgttattcaactactg
aatcccaacagacagaccatttatttcagggacttccggcctctgaaggacagcaggttc
cagctgctgaatttttcgagcagtgaactgaaagtgtcgctgacaaatgtctccatttct
gatgaaggaagatacttctgccagctctacactgaccccccgcaggaaagttacaccaca
atcacagtcctggtcccaccacgtaatctgatgatcgacatccagaaagacactgcggtg
gaaggtgaggagattgaagtcaactgcaccgccatggccagcaagccagccacraccatc
cggtggttcaaagggagcaaggagctcaaaggcaagtcagaggtggaggagtggtcagac
atgtacactgtgacaagtcagctgatgctgaaggtgcacaaggaggatgacggggttcca
gtcatctgtcaggtggagcaccctgctgtcaccggaaacctgcagacccagcggtacctg
gaagtacagtataagcctcaagtgcatattcagatgacttaccctctacaaggcctaacc
cgggaaggggacgcgcttgagttaacatgtgaagccatcgggaagccccagcctgtgatg
gtgacttgggtgagagtcgatgatgaaatgcctcaacatgccgtgctgtcggggcccaac
ctgttcatcaataacctaaacaaaacagataatggtacataccgctgtgaggcttccaac
atagtggggaaagctcattcggattatatgctgtatgtatacgatccccccacaactatc
cctcctcccacaacaacctccaccaccaccaccaccaccaccaccatcctcaccatcatc
acagacaccacggcgacgacagaaccagcagttcacggccttactcagttgcccaattcc
gcagaagaactggacagtgaggacctctcagattctcgagcaggtgaagaaggcgcgatc
agggcggtggatcacgcsgtgattggcggcgtcgtggctgtggtggtgtttgccatgctg
tgtttgctcatcattctggggcgctattttgccagacataaaggtacatacttcactcat
gaagccaaaggagccgatgacgcagcagacgcagacacagctataatcaatgcagaagga
ggacagaacaactctgaagaaaagaaagagtacttcatctag

DBGET integrated database retrieval system