KEGG   Bos indicus (zebu cattle): 109569712
Entry
109569712         CDS       T04792                                 

Gene name
SERPING1
Definition
(RefSeq) plasma protease C1 inhibitor
  KO
K04001  C1 inhibitor
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
biu05133  Pertussis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109569712 (SERPING1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05133 Pertussis
    109569712 (SERPING1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109569712 (SERPING1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109569712 (SERPING1)
Peptidases and inhibitors [BR:biu01002]
 Peptidase inhibitors
  Family I4: serpin family
   109569712 (SERPING1)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109569712 (SERPING1)
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 109569712
NCBI-ProteinID: XP_019830925
Position
15
AA seq 468 aa
MASRLTPLTLLLLLLLAGDRVTSDMIVGPGNLQEGESEGDSQKGGILDGESIQGNEDSPT
LPITNLTVVPATVTKPFSQPATEPVQSTIQPTAEPFCLAPVTSCSDSEIRSAEAVLGEAL
TDFSLRLYQDFSVLKKRETNFIFSPFSIASLLTQILLGAGGETRVSLEHLLSYPQNFSCV
HHALRAFMSEGFTSFSQIFHSSDLTIKDTFAEASQRLYGSSPRPLGNDSTASLELINDWV
AKKTNLRIRRLLDSLPEDTRLILLNAVALSAKWKIAFDKGRTSTKPFHLKSSAIKVPMMN
SKKYPVASFTDRTLNARVGRLQLSHNLSFVILVPQTVKHHLQDLEQALSTAVFKAVIKKL
EMTKFHPTHLTMPRIKVQSSQDMLDYFDFIYDXNLCGLTEDPDVQVSGIRHQATLELTES
GVEATAASVVSVARNLLLFEVQQPFLFLLWDQQHKFPVFMGRVYDPKG
NT seq 1407 nt   +upstreamnt  +downstreamnt
atggcctccaggctgaccccgctgaccctcctgctgctgctgctgctggctggggacaga
gtcacctcagatatgatcgtcggcccagggaacttacaagaaggggaaagtgaaggagac
agccagaaaggaggtattctcgatggtgagtccattcaaggcaacgaggactctcccacc
ttgccgataactaacctgaccgtcgtgccagccactgtcaccaagcccttcagccagcct
gccactgaaccggtccaatcaactatccagcccactgctgagcccttctgcctggcgccy
gtcacctcctgctctgactcggagatccgctcagcagaggcggtgctgggggaggctttg
acagacttctccctgaggctctaccaggacttctcagtgttgaagaagagggagaccaac
ttcatcttttcccccttcagcattgccagcctcctcacccaaatcctgcttggggctgga
ggagaaaccagggtcagcctggagcacctcctctcttacccccagaacttcagctgtgtc
caccacgccctgagggccttcatgtccgaaggtttcacctcgttctctcagatcttccac
agctcagacctgaccatcaaggacaccttcgccgaggcctctcagaggctctatggcagc
agcccgagacccctgggaaatgacagcacagccagcttrgagcttatcaatgactgggtg
gccaagaagaccaacctcaggatcaggcggctgctggacagcctgcctgaggacacccgc
ctcatcctcctcaacgctgtcgccctgagcgccaagtggaagatagcctttgataaaggc
agaacaagcacaaagccctttcacctcaaatcctctgccatcaaagtgcccatgatgaac
agcaagaagtaccctgtggcctctttcacagaccggactctgaacgcccgggtgggccgc
ctgcagctgtctcacaacctcagctttgtgatcctggtgccccagaccgtgaaacaccat
ctccaagacctggagcaggctctcagcaccgccgtcttcaaagctgtcataaagaagctg
gagatgaccaagttccatcccactcacctgacgatgcctcgcatcaaagtgcagagcagt
caggacatgctggattactttgacttcatctacgacrtcaacctgtgcgggctgacggag
gacccrgacgtgcaggtgtctgggatccggcaccaggccaccctggagctgacggagagc
ggggtggaggcractgcggcctcggtcgtctccgtggcccgcaacttgctgctcttcgaa
gtgcagcagcccttcctcttcctgctctgggaccagcagcacaagttcccggtcttcatg
ggtcgggtgtacgaccccaagggctga

DBGET integrated database retrieval system