KEGG   Bos indicus (zebu cattle): 109569718
Entry
109569718         CDS       T04792                                 

Gene name
ATM
Definition
(RefSeq) serine-protein kinase ATM isoform X1
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01524  Platinum drug resistance
biu03440  Homologous recombination
biu04064  NF-kappa B signaling pathway
biu04068  FoxO signaling pathway
biu04110  Cell cycle
biu04115  p53 signaling pathway
biu04210  Apoptosis
biu04218  Cellular senescence
biu05165  Human papillomavirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05170  Human immunodeficiency virus 1 infection
biu05202  Transcriptional misregulation in cancer
biu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    109569718 (ATM)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    109569718 (ATM)
   04068 FoxO signaling pathway
    109569718 (ATM)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109569718 (ATM)
   04210 Apoptosis
    109569718 (ATM)
   04115 p53 signaling pathway
    109569718 (ATM)
   04218 Cellular senescence
    109569718 (ATM)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    109569718 (ATM)
   05206 MicroRNAs in cancer
    109569718 (ATM)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109569718 (ATM)
   05170 Human immunodeficiency virus 1 infection
    109569718 (ATM)
   05165 Human papillomavirus infection
    109569718 (ATM)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    109569718 (ATM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:biu01001]
    109569718 (ATM)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:biu03032]
    109569718 (ATM)
   03400 DNA repair and recombination proteins [BR:biu03400]
    109569718 (ATM)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109569718 (ATM)
Protein kinases [BR:biu01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   109569718 (ATM)
DNA replication proteins [BR:biu03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     109569718 (ATM)
DNA repair and recombination proteins [BR:biu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    109569718 (ATM)
SSDB
Motif
Pfam: PI3_PI4_kinase FAT TAN FATC Uso1_p115_head
Other DBs
NCBI-GeneID: 109569718
NCBI-ProteinID: XP_019830934
Position
15
AA seq 3061 aa
MSLALNDLLICCRQLELDKATERRREIEKFKRLIQDPETVRHLDHHSDSKQGKYLNWDAV
FRFLQKYIQKETEYLRTAKQNVSASTQATRQKKMQEISSLVKDFIKCANKRAPRLKCQEL
LNYIMDTVKDSSSGAXYGADCSNILLKDILSVRKYWCEISQQQWLELFSVYCSLYLKPSQ
DINRVLVARIIQVVTKGCCSQTDGLNPKFLDFFSKAIHQARQEKSPAGLNHILAAFIIFL
KTLSVNFRIRVCELGDEILPTLLYIWTQQRLNNSLKEVIIELFQLQIYIHHPKGAKTQDK
GAYESRKWRSILHNLYDLLVNEISNIGSRGKYTSGSRNIAVKENLIELMADICHQVFNED
SRSLEISQSYTTTQRELTDYSVPCKKRKIELGWEVIKDHLQKSQNDFDIVPWLQIATQLI
SKYPASLPNCELSPLLMILYQLLPQQRRGERTPYVLRCLMEVALCQGKRSNLESSQKSDL
LKIWIKIWSITFRGISSEQIQTENFGLLGAIIQGSLVEVDREFWKLFTGSACRPSCPAVC
CLTLALTICVVPESVTIGIEKNICDVSRNSLKELIMKWLLFCQLEDDFEDSTELPPILCS
NFPHLTLEKILVSLTMKNCKAAMNFFQSVPECEQHQKDTEEPSFSEAEDLFLQTTFDKMD
FLTIVKEHXIEKHQSSVGFSVHQNLKESLDRYLLRLSEQLLNNYSSETSNSEMFVRCSSL
LVGVLGCYCYLGVIAEEEAYKSELFQKAKSLMQXAGESITLFKNKTSEESRIVSLRNMIH
LCTSCLHNCSKHSPNKIASGFFLRLLTSKLMNDIADICKSLAFIIKKPFDFGEVESLKED
TDENLTRMEDQSYTSLFNDSPASSVTDTNESGKSQITXGAMNPLAEEHLSKQDLLSLDML
KFLCMCVTTAQTNTVSFRAADIRRELLMLIDSSMLDPXRSLHLHMYLVLLKALPGEEYPL
PMEDVAKLLKPLPNVCSSYHRDQDVCKTILNHVLHVVMNLCHRNMDDENTRDAQGQFLTV
IGAFWHLTKEGKSTFSVRMALVKCLKTLLEADPYSKWSILNVKGKDLPVNEVFPQFLADN
HHQVRMLAAESINRLFQHIKRGSSTLKALPLKLQQTAFENAYFKAQEGMRELSHRTENSE
TLDEICNRKATLLMMIAVVLYCSPVCEKQALFALCKSVKENGLEPHLVKKVLKTVSETFG
YRCLEDFMASHLDYLVLEWLNLQDPEYSVSSFPFILLNYTNIEDFYRSCYKILIPPLVIR
SHFDEVKLIABQIQEDWKSLLTGCFPKILVNILPYFAYEGTEBSGMAQQRETATKVYDML
KDENLLGKQIDHLFISNLPEIVVELLMTLHEPATSGXSQSTDPCDFSGDLDPAPNPPHFP
SHVIKATFAYISNCHKTKLKSILEILSKSPDSYQKILLAICEQAAETNNVYKRHRIIKIY
HLFVSLLMNDIKSGLGGAWAFVLRDVIYTLIHYINQRPSRFMDVSLRSFSLCCDLLSRVC
HTAVTYCKDALESHLHVIVGTLIPLVDDQMEVQEQVLDLLKFLVIDNKDNENLYITIKLL
DPFPDHVVFKDLRITQQKIKYSGGPFSLLEEINHFLSVSAYDALPLTRLEGLKDLRRQLE
QHKDQMLDLMRASQDNPQDGIMVKLVVSLLQLSKMAVNHTGEREVLEAVGSCLGEVGPID
FSTIAIQHSKDTSYTKALELFEDKELQWTFVVLTYLNNTLVEDCVKVRAAAVTCLKSILT
TKTGHRFWDIYKATTDPMLIYLQPFRTSRKKFLEVLRLDKENPLEGLDDTSLWIPQSENH
DIWLKTLTCAFLNSGGTKSEVLQLLKPMCEVKTDFCQTVLPYLIHDILLQDTDESWRNLL
STHIQGFFTSCFKHPSQTSRSTTPANLDSESEHFFRCHVDKKSQRTMLAVVDYMRRQKRP
SSGTVFDDAFWLELNYLEVAKVAQSCAAHFTALLYAEIYADKKNLDDQEKRDALVTNRSL
TFEEGSQSTTISSLSEKSKEETGISLQDLLLEIYRSIGEPDSLYGCGGGKMLQPLTRLRT
YEHEAMWGKALVTYDLETTISSSTRQAGIIQALQNLGLCHILSIYLRGLDHENKEWCAEL
QELHYQVAWRNMQWDHCISVNKGVERTSYHELLYNALQSLRDREFSTFYESLKHARVKEV
EELCKGSLESVYSLYPTLSRLQXIGELENIGELFSRSVTDKQPSEVYMKWWKHSQLLKDS
DFSFQEPIMALRTVXLEILMEKEMENSQRECFKDILTKHLVELSVLARTFKNTQLPERAI
FQIKQYNSASSGVSEWQLEEAQVFWAKKEQSLALSILKQMIKKLDASCTENDPNLKLIYT
ECLRVCGTWLAETCLENPAVIMQTYLEKAVEVAGNXDGESNDGLRNGKMKAFLSLARFSD
TQYQRIENYMKSSEFENKQALLKRAKEEVGLLREHKIQTNRYTVKVQRELELDECALHAL
KEDRKRFLCKAVENYINCLLSGEGHDMWIFRLCSLWLENSGVSEVNGMMKRDGMKIPSYK
FLPLMYQLAARMGTKMMGGLGFHEVLNNLISRISMDHPHHTLFIILALANANKDEFLTKP
EAARRSRITKNAPKQSSQLDEDRTEAANKIIXTIRSRRPQMVRSVEALCDAYIILANLDA
TQWRTQRKGINIPADQPIIKLKNLEDVVVPTMEIKVDPTGEYGNLVTIKSFKEQFRLAGG
LNLPKIIDCVGSDGKERRQLVKGRDDLRQDAVMQQVFQMCNTLLQRNTETRKRKLTICTY
KVVPLSQRSGVLEWCTGTVPIGEFLVNNENGAHKRYRPKDFSAIHCQKKMMDMQKKSFEE
KYETFMEICQNFQPVFRYFCMEKFLDPAVWFEKRLAYTRSVATSSIVGYILGLGDRHVQN
ILINEQSAELVHIDLGVAFEQGKILPTPETVPFRLTRDIVDGMGITGVEGVFRRCCEKTM
EVMRNSKETLLTIVEVLLYDPLFDWTMNPLKALYLQQRPDDESELHSTLNADDQECKRNL
SDIDQSFNKVAERVLMRLQEKLKGVEEGTVLSVGGQVNLLIQQAMDPKNLSRLFPGWKAW
V
NT seq 9186 nt   +upstreamnt  +downstreamnt
atgagtctagcacttaatgatctgcttatttgctgccgtcaactagaacttgataaagct
acagagcgaaggagagagattgagaaatttaagcgcctgattcaggatcctgaaactgtt
cgacatttagatcaccattcagattccaaacaagggaaatatttgaattgggatgctgtt
tttaggtttttacagaaatatattcagaaagaaacagaatatctgagaacagcaaaacaa
aatgtatcagcctcgacacaagccactaggcagaaaaagatgcaagaaatcagtagcttg
gtcaaggacttcatcaaatgtgcaaataaaagagcacccaggctgaaatgtcaagaactg
ttgaattatatcatggatacagtgaaagattcatccagtggtgctayttatggagctgat
tgtagcaatatattgctgaaggacattctttcagtgaggaaatactggtgtgaaatatct
cagcaacagtggctggaattgttctctgtgtactgcagtctatatcttaaaccttcacaa
gacattaatagagttttggtggcaagaataattcaagttgtgaccaaaggatgctgttca
cagaccgatggattaaatcccaaatttttggattttttttctaaggctattcaccaggca
cgccaagaaaagagccctgcaggtctaaatcatatcttagcagcatttattatctttctc
aagactttgtctgttaactttcgaattcgagtatgtgaattaggagatgaaattcttcct
accttactttatatttggactcaacagagacttaataattccttaaaagaagtaattatt
gaattatttcagctacaaatttatattcatcatccaaagggagccaaaactcaagataaa
ggtgcttatgaatcaagaaagtggagaagtattttacacaacctgtatgatttgttagtt
aatgaaataagtaatataggaagcagagggaaatacacttcaggatctcgtaatattgct
gttaaggaaaacttgattgaattgatggcagatatttgtcaccaggtttttaatgaagat
tccagatctttggagatttctcagtcttacacaaccacacaaagagaacttactgattac
agtgtaccttgcaaaaagaggaagatagaattaggctgggaagtaataaaagatcacctt
cagaagtcacagaatgattttgatattgtaccttggttacaaatcgcaactcaattaata
tcaaaatatcctgcaagtttacctaactgtgagttgtcaccattactaatgatactatac
cagcttttacctcaacagcgacgtggggaacgcacaccatatgtgttacgatgtcttatg
gaagttgcattgtgtcaaggcaagagatcaaacytagaaagctcacaaaagtcagattta
ttgaaaatctggattaaaatttggtctattacttttcgtggtataagttctgaacaaata
caaacygaaaacttcggcttacttggagccataattcaaggcagtttagttgaggttgac
agagaattctggaagttatttactgggtcagcctgtagaccttcatgtcccgcagtatgc
tgtttgactttggcrctgacaatctgtgtagttccagaatcagtaacaataggaattgag
aaaaatatatgtgatgtaagcagaaattctttaaaggaattgataatgaaatggctctta
ttctgtcagttagaggatgactttgaagacagtacagaactacctccaattctttgcagt
aattttcctcatcttaccctggagaaaattctcgtgagtctcactatgaaaaactgtaaa
gcagcaatgaattttttccaaagtgtgccagaatgtgagcaacaccaaaaagatacagaa
gaaccttcattctcagaagctgaagatctgtttcttcagacaacttttgacaagatggat
tttttaaccattgtgaaagaacatryaatagaaaagcaccaatccagtgtaggcttttct
gtccaccaaaacctcaaggagtcactggatcgctatcttctgagactgtcagaacagctt
ctaaataactactcatctgagacttcaaattcagagatgtttgtccggtgttcaagtctt
ytggtgggtgttcttggctgctattgttacctgggtgtcatagctgaagaggaagcatac
aaatcagaattattccagaaagccaagtctctaatgcagtrtgctggagaaagtatcact
ttgtttaaaaataagacaagtgaagaatctagaattgtttcattgagaaatatgatacat
ctatgtacaagttgcttacataactgttccaagcacagtccaaataagattgcatctggc
ttcttcttacgattattaacatcaaagctaatgaatgacattgcagatatttgtaaaagt
ttagcattcattatcaaaaagccttttgactttggagaagtagaatcactgaaagaagat
actgatgaaaatctaacgaggatggaggatcagtcatayacgagtttatttaatgattcc
cctgctagtagtgttactgatacaaatgaatctggaaagagccaaattactaytggtgcc
atgaatcctttagctgaagaacatctgtcaaagcaagatctactttctttagacatgctc
aagttcttgtgtatgtgtgtaaccactgctcagactaacactgtgtcatttagggcagct
gatattcggagggaattattaatgttaattgattctagcatgctagaccctamcagatct
cttcatttacacatgtatctagtgcttttaaaggcgcttcctggagaagaataycccttg
ccaatggaagatgttgcaaaacttctaaaaccactacccaatgtgtgttcatcttatcac
cgtgaccaagatgtttgtaaaaccattttaaaccatgtccttcacgtagtgatgaacctg
tgtcacagaaatatggatgatgagaacacaagggatgctcaaggacagtttctaacagtg
attggagcattttggcacttaacaaaggaggggaaaagtacattctctgtaagaatggca
ctagtaaaatgccttaaaactttgcttgaggctgatccttattcaaaatggtctattctg
aatgtaaagggaaaagatcttcctgtaaatgaagtatttccacagtttcttgctgataat
catcaccaagttcgcatgttggctgcggagtcaatcaatagattgtttcagcatataaaa
cgaggttcttccacattgaaagcacttcctttgaagcttcagcaaacagcttttgaaaat
gcatactttaaagctcaggaaggaatgagagaattgtcccacagaactgaaaactcygaa
actttggatgagatttgtaatagaaaagccactttactgatgatgatagctgtggtgtta
tactgtagccctgtctgtgaaaagcaggctttattcgccctatgcaagtctgtgaaagag
aatggactagagcctcacctcgttaaaaaggttttaaagacagtttctgaaacttttgga
tatagatgtttagaagatttcatggcttctcatttggattatttggtattggaatggcta
aatcttcaagatcctgaatacagtgtatcttcttttccttttattttattaaattacaca
aacattgaagatttctataggtcttgttataaaattttgattccacctctagtgattaga
agtcattttgatgaagtaaagttaattgctratcaaattcaagaggattggaaaagtctt
ctgacaggctgctttccaaagattcttgtaaatatccttccatactttgcttatgarggt
acagaaracagtgggatggcacagcaaagagagactgctaccaaagtctatgatatgctt
aaagatgaaaacttattaggaaaacagattgatcatttattcattagtaatttaccagag
attgtagtggagttattgatgacgttacatgaaccagcaacttctggtrccagccaaagc
actgacccctgtgacttctcaggggatttggatcctgctcctaatccacctcattttcca
tcacatgtgattaaagcgacatttgcctatatcagcaattgccataaaaccaagcttaaa
agcattttagaaattctttccaaaagccctgattcctatcagaaaattcttctagccata
tgtgagcaagcagctgagacaaataatgtttacaaaaggcacagaattattaaaatatat
cacctgtttgttagtttattaatgaatgatataaagagtggcttaggaggagcttgggcc
tttgttcttcgagatgttatttatactttgattcactatatcaaccaaaggccttctcgt
ttcatggatgtgtcattacgtagcttctccctttgttgtgacctattaagccgggtttgc
cacacagcggtaacttactgtaaggatgctttagaaagtcatcttcatgttattgttggt
acacttataccccttgtggatgatcagatggaagttcaggaacaggtattggacttgttg
aaattcttagtgattgataacaaggataatgaaaatctgtatatcacaattaaactttta
gatccttttcctgaccacgttgtctttaaggatttgcgtattactcagcagaaaatcaaa
tacagtggaggacccttttcacttttggaggaaattaaccattttctctcagtaagtgct
tatgatgcacttccattgacaaggcttgaaggattgaaggatcttcgaagacaactagag
caacataaagatcagatgctggatcttatgagagcatctcaggataaccctcaggatggc
ataatggtgaagctggttgtcagcttgttgcagttatccaagatggcagtaaaccacact
ggtgaaagagaagttttagaggctgttggaagctgcttgggagaagtgggtcctatagat
ttctctacaatagctatacaacatagtaaagatacatcttataccaaggctcttgagtta
tttgaagataaagaacttcagtggaccttcgtagtgctgacttacctgaataatacactg
gtagaagattgtgtcaaagtgcgagcagcagctgttacctgtttgaaaagcattttaacc
acgaaaactggacatcgtttctgggatatttataaggcaacaactgatcccatgctgatc
tatctacagccttttagaacatcaagaaaaaagtttttagaagtactaagacttgataaa
gaaaatcctttagaaggcttggatgatacaagcctgtggattcctcaaagtgaaaatcat
gacatttggttaaagacactgacttgtgcttttttgaatagtggtggcacaaaaagtgaa
gttcttcagttattaaagccaatgtgtgaggtgaaaactgacttttgtcagactgtgctt
ccatacttgattcatgatattctactacaagatacagatgaatcatggagaaatctcctt
tctacacacattcagggatttttcactagctgtttcaaacacccttcacaaacaagccga
tccacaacccctgcaaatttggattcagagtcagagcacttttttcgatgccatgtggat
aaaaaatcacaaagaacratgcttgctgttgtggactacatgaggagacaaaagagacct
tcttcaggaacagtttttgatgatgctttctggctggagttaaattatctagaggttgcc
aaagtagctcagtcttgtgctgctcattttaccgcattgctctatgcagaaatctatgca
gataagaagaacttggatgatcaagagaaaagagatgctcttgtgacaaacagaagtctt
acatttgaagaaggaagccaaagtacaactatttccagtttgagtgaaaaaagtaaggaa
gaaactgggataagtttacaggatctgcttttagaaatctacagaagtataggagagcca
gatagtctttatggctgtggtggagggaaaatgttacaaccccttactagactacgaaca
tatgaacatgaagcaatgtgggggaaagccctagtaacatatgaccttgagaccacaatc
tcctcatcaactcgtcaggcaggaataattcaggccttgcagaatttgggactctgccat
attctttccatctatttaagaggattagatcatgaaaataaagagtggtgtgctgaacta
caggaacttcattaccaagtagcatggaggaatatgcagtgggaccactgcatttctgtc
aacaaaggagtggaaagaaccagttaccacgagttgttgtacaatgctctgcagtctcta
agagacagagaattctccactttttatgaaagtctcaaacaygccagagttaaagaagtg
gaagagttgtgtaagggcagtcttgagtctgtgtattccctctaccctacacttagcaga
ttgcagrccattggagagcttgaaaacattggagaacttttctcaagatcagtaacagat
aagcagccctctgaagtgtacatgaartggtggaaacattcccagcttctcaaagacagt
gattttagttttcaggagcctataatggccctacgcacagtcrttttggagatcttgatg
gaaaaggaaatggaaaactcccaaagagagtgttttaaggacattctcaccaagcatctt
gtagaactctctgtattagctcgaactttcaagaacactcagctccctgaaagggcaata
tttcaaattaaacagtataattcagctagtagtggagtctctgagtggcaactggaggaa
gcacaagtattctgggcaaaaaaggaacagagtcttgccctgagtattctcaagcaaatg
atcaagaagctggatgccagttgtacagagaatgatcccaacttaaaacttatatacaca
gaatgtctaagggtttgtggtacctggttagcagaaacttgcttagaaaatcctgcagtc
atcatgcagacctatctagaaaaggctgtggaagttgctggaaattwtgatggagaaagc
aatgatgggctcagaaatggaaaaatgaaggcatttctctcattagcacggttctcagat
actcagtaccaaagaattgaaaactacatgaaatcatcagaatttgaaaacaagcaagct
ctcctgaaaagagccaaagaggaagttggcctacttagggaacataaaatccagaccaac
agatacacagtaaaggttcagcgagagctggagttggatgaatgtgcactccatgcattg
aaagaggatcgtaaacgtttcttatgtaaagcagttgaaaattacatcaattgcttatta
agtggcgaagggcatgatatgtggatatttcgtctttgttctctctggcttgaaaattct
ggagtttctgaagtcaatggcatgatgaagagagatggaatgaagattccatcatacaaa
tttttgcctcttatgtaccaactggctgctagaatggggaccaagatgatgggaggccta
ggatttcatgaagtcctcaataatctcatctctagaatttcaatggatcatcctcatcac
actttgtttattatattggctttagcaaatgcaaacaaggatgaatttttgaccaaacca
gaggcagccagaaggagtagaattactaaaaatgcaccaaaacaaagctctcagcttgat
gaggatcgaaccgaggctgctaacaaaataatacrtactatccgaagtaggagacctcag
atggtcagaagtgttgaggcactttgtgatgcttatattatactagcaaatttagatgcc
actcagtggaggactcagagaaaaggcataaatattccagcagaccagcccattatcaaa
cttaaaaatttagaagatgttgttgtccctactatggaaattaaggtggaccccacagga
gaatatggaaatctggtgactataaagtcatttaaagaacaatttcgtttagcaggaggt
ttaaatttaccaaaaataatagattgtgtgggctctgatggaaaggaaaggagacagctt
gtcaagggccgtgatgacctgagacaagatgccgtcatgcagcaggttttccagatgtgt
aatacattactgcagagaaatactgaaaccaggaagaggaaattgactatttgtacttat
aaggtggttcccctttctcagcgaagtggcgttcttgaatggtgcacaggaactgtccct
attggtgaatttcttgttaacaatgagaatggtgctcataaaagatacaggccaaaggat
ttcagtgccattcactgccaaaagaaaatgatggatatgcagaaaaagtcttttgaagag
aaatatgaaactttcatggagatttgccaaaattttcaaccagttttccgttacttctgc
atggaaaaattcttggatccagcagtgtggtttgagaaacgattggcttatactcggagt
gtggctacttcttctattgttggttacatacttggacttggtgatagacatgtacagaat
atcttgataaatgagcagtcagcagaacttgtacatatagatttaggagttgcttttgaa
cagggcaaaatccttcctactcctgaaacagttccttttagacttaccagagatattgtg
gatggaatgggcattactggtgttgaaggtgtcttcagaagatgctgtgagaaaaccatg
gaggtaatgagaaattctaaggaaaccctgttaaccattgtagaggtcctcctatatgat
cctctctttgactggaccatgaatcctctaaaagctttatatttacaacagaggccagac
gatgaaagtgagctccactccactctaaatgcagatgaccaggaatgcaaacgaaatctc
agtgatattgaccagagtttcaacaaagtagctgaacgtgtcttgatgagactgcaagag
aaactaaaaggagtagaggaaggaaccgtgctcagtgttggtggacaggtgaatttgctc
atacagcaggccatggacccgaaaaatctcagccgacttttcccaggatggaaagcttgg
gtgtga

DBGET integrated database retrieval system