KEGG   Bos indicus (zebu cattle): 109569753
Entry
109569753         CDS       T04792                                 

Gene name
CD59
Definition
(RefSeq) CD59 glycoprotein
  KO
K04008  CD59 antigen
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
biu04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109569753 (CD59)
   04610 Complement and coagulation cascades
    109569753 (CD59)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109569753 (CD59)
   04090 CD molecules [BR:biu04090]
    109569753 (CD59)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:biu00537]
    109569753 (CD59)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109569753 (CD59)
  Exosomal proteins of other body fluids (saliva and urine)
   109569753 (CD59)
  Exosomal proteins of colorectal cancer cells
   109569753 (CD59)
CD molecules [BR:biu04090]
 Proteins
  109569753 (CD59)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:biu00537]
 Antigens
  109569753 (CD59)
SSDB
Motif
Pfam: UPAR_LY6
Other DBs
NCBI-GeneID: 109569753
NCBI-ProteinID: XP_019830998
Position
15
AA seq 121 aa
MASKGGYIVLGLLFLAVLCQLGHSLQCYSCINQVNCTSIVNCSHNQDACLFVKAVPLKFY
HQCWKYEECSFEFIAKALGEKELHYDCCQKNLCNKSGGRSVSEKMLLLLTLLLEAVCHFY
R
NT seq 366 nt   +upstreamnt  +downstreamnt
atggcaagcaaaggagggtacatcgtgcttgggctcctgttcctggctgtcctctgccaa
ctcggtcacagcctgcagtgctacagctgtattaaccaagttaactgcacttcaatcgtc
aattgttcacataatcaagatgcttgtctcttcgttaaggctgtgccgctaaaattttac
caccagtgttggaagtacgaagaatgcagttttgagttcattgcaaaagccttaggggag
aaggagctccactatgactgctgccagaagaacctgtgtaacaaaagtggcgggaggagc
gtatccgagaagatgctgctgctgctcaccctgctgctggaggcagtctgccacttttat
cgctaa

DBGET integrated database retrieval system