KEGG   Bos indicus (zebu cattle): 109569809
Entry
109569809         CDS       T04792                                 

Gene name
CD28
Definition
(RefSeq) T-cell-specific surface glycoprotein CD28
  KO
K06470  CD28 antigen
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu04660  T cell receptor signaling pathway
biu04672  Intestinal immune network for IgA production
biu04940  Type I diabetes mellitus
biu05162  Measles
biu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
biu05320  Autoimmune thyroid disease
biu05322  Systemic lupus erythematosus
biu05323  Rheumatoid arthritis
biu05330  Allograft rejection
biu05332  Graft-versus-host disease
biu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109569809 (CD28)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    109569809 (CD28)
   04672 Intestinal immune network for IgA production
    109569809 (CD28)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109569809 (CD28)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    109569809 (CD28)
   05323 Rheumatoid arthritis
    109569809 (CD28)
   05320 Autoimmune thyroid disease
    109569809 (CD28)
   05330 Allograft rejection
    109569809 (CD28)
   05332 Graft-versus-host disease
    109569809 (CD28)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109569809 (CD28)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109569809 (CD28)
  09172 Infectious disease: viral
   05162 Measles
    109569809 (CD28)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109569809 (CD28)
CD molecules [BR:biu04090]
 Proteins
  109569809 (CD28)
SSDB
Motif
Pfam: V-set_2 V-set DUF588
Other DBs
NCBI-GeneID: 109569809
NCBI-ProteinID: XP_019831089
Position
2
AA seq 265 aa
MCPETSKLAVVAADDESSHSSVSSVPLTLGLLREEGLEPWPTVSTMILRLLLALNFFPSI
QVAENKILVKQSPMLVVNDNEVNLSCKYTYNLFSKEFRASLYKGADSAVEVCAVNGNHSH
PLQSTNKEFNCTVKVGNETVTFYLQDLYVNQTDIYFCKLEVLYPPPYIDNEKSNGTIIHV
KEKHLCPSPRSPESSKPFWALVVVNGVLVFYSLLVTVALSNCWMKNKRNRMLQSDYMNMT
PRRPGPTRRHYQPYAPARDFAAYRS
NT seq 798 nt   +upstreamnt  +downstreamnt
atgtgccctgagacaagtaagttggcggtggtggcygcggatgacgagtcgagtcactca
agtgtgtcttcggttcccctcacacttgggcttctcagggaggaggggctggagccgtgg
cccaccgtcagcaccatgatcctcaggctgctcctggctctcaacttcttcccctcaatt
caagtagcagaaaacaagattttggtgaagcagtcgcccatgcttgtggtaaacgacaat
gaggtcaacctcagctgcaagtacacgtacaacctcttctcaaaggagttccgggcatcc
ctttataagggagcagatagcgctgtggaggtctgtgctgtgaatggaaaccactcccat
ccacttcagtcaacaaataaggaattcaactgcaccgtgaaagtaggcaatgaaacggtg
actttctacctccaggatctgtatgtcaaccaaacagatatttatttctgcaaacttgag
gttctttatcctcctccttacatagacaatgagaagagtaatgggaccattatccatgtg
aaagagaaacatctttgtccatctccccggtctcctgagtcttctaagccattttgggcc
ttggtggtggtaaacggagtcctagttttctatagcttgctagtaacagtggctctttct
aactgctggatgaagaataagagaaacaggatgcttcagagcgactatatgaacatgacc
ccccgcaggccagggcccacccggaggcactaccagccctatgcgccggcacgggacttt
gcggcctaccgctcctga

DBGET integrated database retrieval system