KEGG   Bos indicus (zebu cattle): 109569818
Entry
109569818         CDS       T04792                                 

Gene name
CTLA4
Definition
(RefSeq) cytotoxic T-lymphocyte protein 4 isoform X1
  KO
K06538  cytotoxic T-lymphocyte-associated protein 4
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu04660  T cell receptor signaling pathway
biu05320  Autoimmune thyroid disease
biu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109569818 (CTLA4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    109569818 (CTLA4)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    109569818 (CTLA4)
   05320 Autoimmune thyroid disease
    109569818 (CTLA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109569818 (CTLA4)
CD molecules [BR:biu04090]
 Proteins
  109569818 (CTLA4)
SSDB
Motif
Pfam: V-set Ig_3 V-set_2 I-set
Other DBs
NCBI-GeneID: 109569818
NCBI-ProteinID: XP_019831101
Position
2
AA seq 221 aa
MACSGFQSHGTWWTSRTWPCTALFFLVFIPVFSKGMNVTQPPVVLASSRGVASFSCEYES
SGKADEVRVTVLREAGSQVTEVCAGTYMVEDELTFLDDSTCIGTSRGNKVNLTIQGLRAM
DTGLYVCKVELMYPPPYYVGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLIT
AVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
NT seq 666 nt   +upstreamnt  +downstreamnt
atggcttgctctggattccagagtcatgggacttggtggacatctaggacctggccctgc
actgccctattttttcttgtcttcattcctgttttctctaaagggatgaatgtgacccag
cctccagtggtgctggctagcagccggggtgttgccagcttctcatgtgaatatgagtct
tcaggcaaagctgacgaggtccgggtgacagtgctgcgggaggcaggcagccaggtgacc
gaagtctgtgctgggacctacatggtggaggatgagctaaccttcctggatgattccact
tgcattggcacctccagaggaaacaaagtgaacctcaccatccaagggctgagggccatg
gacactgggctytatgtctgcaaagtggagctcatgtacccgccgccctactacgtgggc
atcggcaatggaacccagatttacgtcattgatccagaaccatgcccggattctgatttt
ctcctctggatcctggcagcagttagttcagggttgtttttctacagcttcctcatcaca
gctgtttctttgagcaaaatgctaaagaaaagaagccctcttactacaggggtctatgtg
aaaatgcccccaacagagccagaatgtgaaaagcaatttcagccttattttattcccatc
aattga

DBGET integrated database retrieval system