KEGG   Bos indicus (zebu cattle): 109569829
Entry
109569829         CDS       T04792                                 

Gene name
ICOS
Definition
(RefSeq) inducible T-cell costimulator
  KO
K06713  inducible T-cell co-stimulator
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu04660  T cell receptor signaling pathway
biu04672  Intestinal immune network for IgA production
biu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109569829 (ICOS)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    109569829 (ICOS)
   04672 Intestinal immune network for IgA production
    109569829 (ICOS)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    109569829 (ICOS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109569829 (ICOS)
CD molecules [BR:biu04090]
 Proteins
  109569829 (ICOS)
SSDB
Motif
Pfam: V-set_2
Other DBs
NCBI-GeneID: 109569829
NCBI-ProteinID: XP_019831123
Position
2
AA seq 209 aa
MKSDLRYFFLFCIQVEILAGEFNDSAASEMFIFHNGGVQILCKYPDTVRQFKMQLLKGDN
VLCDLTKTKENEDTVSIRNLNVCKFQLSNNSVSFFLYNLDSSYASYYICKLSIFDPPPFQ
VDILSREYLNIYESELCCQLKFWLPIGCAAFVTVCVFGCVLMYWLTKKKYPTSVHDPNSE
YMFMAAVNTAKKPAPTDVTRNLELPGTQA
NT seq 630 nt   +upstreamnt  +downstreamnt
atgaagtcagacctccggtatttctttctcttctgcatccaagttgaaattctagcagga
gaattcaatgattctgctgcatctgagatgttcatatttcacaatggaggtgtacaaatt
ttatgcaaataccctgatactgttcgacaatttaaaatgcagttgctgaaaggggataat
gtactctgtgatctcactaagactaaggaaaatgaagacacagtatccatcaggaatctg
aatgtctgtaaatttcagttatccaataatagtgtctctttttttctatataatttggac
agttcttatgccagctattacatctgcaaaytgtcaatttttgatcctcctccttttcaa
gtagatattctaagcagagaatatttgaatatttatgaatcagagctttgttgccagctg
aagttctggttacccataggatgtgcagcttttgttacagtctgcgtttttggatgtgtc
cttatgtattggcttacaaaaaagaagtatcccaccagcgtgcatgaccctaacagtgaa
tatatgttcatggcagcggtgaacactgctaaaaagcctgcacccacagatgtgacccgt
aatttggaactccctggcacccaggcatga

DBGET integrated database retrieval system