KEGG   Bos indicus (zebu cattle): 109570005
Entry
109570005         CDS       T04792                                 

Gene name
LRRC4C
Definition
(RefSeq) leucine-rich repeat-containing protein 4C
  KO
K07523  netrin-G1 ligand
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04360  Axon guidance
biu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109570005 (LRRC4C)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    109570005 (LRRC4C)
SSDB
Motif
Pfam: LRR_8 LRR_5 LRR_4 I-set Ig_3 ig V-set LRR_9 Ig_2 Ig_6 LRR_1 Insulin_TMD Syndecan
Other DBs
NCBI-GeneID: 109570005
NCBI-ProteinID: XP_019831396
Position
15
AA seq 640 aa
MLNKMTLHPQQIMIGPRFNRALFDPLLVVLLALQLLVVAGLVRAQTCPSVCSCSNQFSKV
ICVRKNLRDVPDGISTNTRLLNLHENQIQIIKVNSFKHLRHLEILQLSRNHIRTIEIGAF
NGLANLNTLELFDNRLTTIPNGAFVYLSKLKELWLRNNPIESIPSYAFNRIPSLRRLDLG
ELKRLSYISEGAFEGLSNLRYLNLAMCNLREIPNLTPLIKLDELDLSGNHLSAIRPGSFQ
GLMHLQKLWMIQSQIQVIERNAFDNLQSLVEINLAHNNLTLLPHDLFTPLHHLERIHLHH
NPWNCNCDILWLSWWIKDMAPSNTACCARCNTPPNLKGRYIGELDQNYFTCYAPVIVEPP
ADLNVTEGMAAELKCRASTSLTSVSWITPNGTVMTHGAYKVRIAVLSDGTLNFTNVTVQD
TGMYTCMVSNSVGNTTASATLNVTAATTTPFSYFSTVTVETMEPSQDEARTTDNNVGPTP
VIDWETTNVTTSLTPQSTRSTEKTFTIPVTDINSGIPGIDEVMKTTKIIIGCFVAITLMA
AVMLVIFYKMRKQHHRQNHHAPTRTVEIINVDDEITGDTPMESHLPMPAIEHEHLNHYNS
YKSPFNHTTTVNTINSIHSSVHEPLLIRMNSKDNVQETQI
NT seq 1923 nt   +upstreamnt  +downstreamnt
atgttgaacaagatgaccttacatccacagcagataatgataggtcctaggtttaacagg
gccttatttgaccccctgcttgtggtgctgctggctcttcaacttcttgtggtggctggt
ctggtgcgggctcaaacctgcccttccgtctgctcctgcagcaaccagttcagcaaggtg
atttgcgttcggaaaaacctacgtgatgttccagatggcatctccaccaacacccggctg
ctgaacctccatgagaaccaaatccagatcatcaaagtgaacagcttcaaacacttgagg
cacctggaaatcctacagttgagtaggaatcatatcagaacaattgaaatcggagccttc
aatggtctggcaaacctcaacacgctggaactctttgacaatcgtcttacgaccatcccg
aatggagcttttgtatatttgtctaaactgaaggagctctggttgcgaaacaaccccatc
gaaagcatcccttcttatgcttttaacagaatcccttctttgcgccggctagacttaggg
gaattgaaaaggctttcatacatctcagaaggtgcctttgaaggtctgtctaacttgagg
tatttgaaccttgccatgtgcaatctccgagaaatccctaacctcacgccgctcataaaa
ctagatgagctggatctttctgggaatcatctatctgccatcaggcctggctctttccag
gggttgatgcaccttcagaaactgtggatgatacagtcccagattcaagtgattgaacgg
aatgcctttgataaccttcagtcactggtggagatcaacctggcacacaacaatctgaca
ttactgcctcatgacctcttcacacccttgcatcatctagagcggatacacttacatcac
aacccctggaactgtaactgtgacatcctgtggctcagctggtggataaaagacatggcc
ccctccaatacagcttgctgtgcccggtgtaacacccctcccaatctgaaagggaggtac
attggggagcttgaccagaattatttcacatgctatgctcctgtcattgtggagccccca
gcagacctcaatgtcactgaaggcatggcagctgagctgaaatgtcgggcctccacgtcc
ctaacctccgtatcttggattactccaaacggaacagtyatgacacatggggcatataaa
gtgcggatagccgtgctcagtgatggcacgttaaacttcacgaatgtaaccgtgcaagat
acaggcatgtacacatgtatggtgagtaattctgtgggaaataccaccgcttcagccacc
ctgaatgttactgcagcaaccactactcccttctcttacttttcaactgtcacggtagag
actatggaaccttctcaggatgaggcacggaccacagataacaatgtgggtcccactcca
gtgatcgactgggagaccactaacgtgaccacctccctcacgccacagagcacaaggtca
acagaaaagacattcaccatccctgtgactgatataaacagtgggatcccaggaattgat
gaggtcatgaagactaccaaaatcatcattggctgtttcgtggccatcacactcatggct
gcagtgatgctggtcattttctacaagatgaggaagcagcatcatcggcaaaaccatcat
gccccaacgaggactgttgaaattattaatgtggatgatgagattacaggagacacrccc
atggaaagccacctgcccatgcctgcgattgagcatgagcacctcaatcaytataactct
tacaaatctcctttcaaccacacaacaacagttaacacaataaattcaatacacagttca
gtgcatgaaccgttattgatccggatgaactctaaagacaatgtccaagagactcaaatc
taa

DBGET integrated database retrieval system