KEGG   Bos indicus (zebu cattle): 109570212
Entry
109570212         CDS       T04792                                 

Definition
(RefSeq) membrane cofactor protein-like
  KO
K04007  membrane cofactor protein
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
biu05162  Measles
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109570212
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    109570212
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109570212
   04090 CD molecules [BR:biu04090]
    109570212
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   109570212
CD molecules [BR:biu04090]
 Proteins
  109570212
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 109570212
NCBI-ProteinID: XP_019831547
Position
16
AA seq 536 aa
MLLVVLVLLLPSVSDACGDPPRFETMRLRGAPKPRYGPGERVQYDCRLGFKPIIPLRPRS
AVCEDDNTWSALEEACTRKSCPNLGDPVNGQVYFVNGSVLFGSQAHFVCNQGFYLIGARI
LYCEISENNVNWNDDSPICEKILCSTPGNIKNGRFTVYKDEYQYNEIVIYMCDPSNGPDE
YSLVGESTLICVDYDRWSSDPPECKVVKCDYPVVEHGMILSGFRRKFYYKAQVVFKCNQG
FYLHGSSTIVCNANSVWEPKLPTCTKGTKVLVQIQPQRQARQVRSSSKYNHSAKLDRLTY
VSPTVDLEPEYFEDFVIAAGIVTACLYKYSAERTERKGGRVCSLVAGSEGPRYVSALWCE
AGGTGSPLGDEPPSTPPLVLPTGAHTVASPVXCCAGSPSTALSPTSVMGMIPAISLVILQ
ARVSQDHQCRSLSVYALISAALHFXGEPRFLPYTPAGGRHTTLQALRNACSQPSSSSGSI
LHSLGALAPLASADARRRLGSAGRRHRPSAQVCFACGKLNGALSADSXKLSFCPSQ
NT seq 1611 nt   +upstreamnt  +downstreamnt
atgcttttggtggtcctcgtgctcctgctgccctccgtctccgatgcctgtggtgatcca
ccaaggtttgaaactatgcggctccggggtgcgcctaaacccaggtatggtcctggggaa
cgtgtacaatatgactgtcgcctaggtttcaagcccataattcctcttcgtcccagatct
gctgtttgtgaggatgacaatacatggtcagctcttgaggaggcctgtacaagaaaatca
tgtcctaatctgggygatccagtgaatggtcaagtttacttcgtcaatggaagtgttctg
tttggttcacaggctcactttgtttgtaatcagggtttttatctgattggagcaagaatt
ctatattgtgaaatttctgaaaataatgtgaactggaatgatgattccccaatatgtgaa
aagattttgtgttccacacctggaaatataaaaaatggaagatttaccgtttacaaggat
gaatatcagtataatgagatagtaatttatatgtgtgatccttcaaatggaccagatgaa
tattctcttgttggrgagagtacgcttatttgtgttgattatgacagatggagcagtgat
cctccggagtgtaaagtggtcaaatgtgactatccagttgttgaacatggaatgatatta
tcrggatttagaagaaaattttactacaaagcgcaagttgtatttaaatgtaaccagggt
ttttaccttcatggcagcagcacaattgtctgtaatgcaaacagtgtttgggagcccaag
ttaccaacgtgtactaaaggtacgaaggtcctcgtccaaatacaaccacagcgccaagct
cgacaggtccggtcctcgtccaaatacaaccacagtgccaagctcgacaggttgacatat
gtctctccaactgttgacttagagcctgaatattttgaggacttcgttattgccgctgga
atagttactgcctgcctgtacaaatattccgcagagcggacagagaggaaagggggcagg
gtctgctccttagttgcyggatcagaaggccccagatatgtttccgcgctgtggtgtgaa
gcaggcgggactgggagccccctgggagatgagccgcccagtactcctccactggttctg
cccacaggcgcgcacactgtggcgtcacctgtcayctgttgtgcgggctcaccaagtact
gccctcagccccacgtcagtcatgggtatgataccagcaatcagtcttgtcatccttcag
gcacgggtttcacaagaccatcagtgccgatcgctaagtgtctatgcmctgatatcagcg
gcgcttcacttytrgggggagcccaggtttcttccatatacacctgccggtggccgccat
actacactccaggcccttcggaacgcctgcagccagccctcgtcctcttctgggtcaatc
ctccatagtctcggtgccctggccccgcttgcatcagcggatgcacgtcgcaggctgggg
agcgcagggcggcggcacagaccgtcagcgcaggtctgctttgcctgcggaaaactgaat
ggcgcgctctccgctgactcctsgaagctctctttctgtcccagccagtga

KEGG   Bos indicus (zebu cattle): 109570213
Entry
109570213         CDS       T04792                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: membrane cofactor protein-like
  KO
K04007  membrane cofactor protein
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
biu05162  Measles
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109570213
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    109570213
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109570213
   04090 CD molecules [BR:biu04090]
    109570213
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   109570213
CD molecules [BR:biu04090]
 Proteins
  109570213
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 109570213
NCBI-ProteinID: XP_019831548
Position
16
AA seq 403 aa
MLLAVLVLLLPSVSEACGDPPRFKTMMLQGEPKPNYRPGECVQYECRLGFKPKLPALPRS
AVCQDNNTWSSLQDACVGKSCPNLGDPANGQVNFVNGSVLFGSQAHVSCNPGFYLIGAKV
IYCEISGDNVNWSDNLPICEIILCATPGNITNGRFTQYKEVYQYSEVVIYRCDPSHGPDE
YSLIGETTLICVDHNRWSSDPPECKVVKCDYPIVENGAIVSGFRGKYYYNMQVVFQCHDG
FHLHGSSTIVCGANGTWEPKLPKCSAICQPPPEILSGQHIPRHKAEFSPGQEVFHSCEPG
CGVREDASLHCSSQXEWNRAAPRVLXPIFSSVKACADFLDPLLNGHMLFPLHFQLSIKVS
FFCDEGFQLKGSSASHCVLVGMKSPWNSSIPVCEQQCSYEYKE
NT seq 1212 nt   +upstreamnt  +downstreamnt
atgcttttggcggtcctcgtgctcctgctgccctccgtctccgaggcttgtggtgatcca
ccaagatttaaaactatgatgctccaaggtgagcctaaacccaattatcgtcctggggaa
tgtgtacaatatgagtgtcgtctaggtttcaagcccaagcttcctgctctccccagatct
gctgtttgtcaagataataatacatggtcgtctctccaggatgcctgtgtaggaaaatca
tgtcctaatctaggagatcctgcgaatggccaagttaacttcgtgaatggaagtgttctg
tttggttcacaggctcacgtttcttgtaatccaggtttttatctgattggagcaaaagtt
atatattgtgaaatttctggagataatgtgaactggagtgataatctcccaatttgtgaa
ataattctgtgtgcaacacctggaaatataacaaacggaagattcacccagtataaggaa
gtatatcaatacagtgaagtggtaatatacaggtgtgatccttctcatgggccagatgaa
tattctcttattggggaaaccacccttatttgtgttgatcataacagatggagcagtgac
ccaccagagtgcaaagtggtcaaatgtgactatccaatcgtcgaaaatggagcaatagta
tcaggatttagaggaaaatattactacaatatgcaagttgtatttcagtgccatgatggt
tttcaccttcacgggagtagcacaattgtctgtggtgcaaatgggacctgggagcccaag
ctaccaaagtgctctgcaatatgccaaccacctccagaaatcctgtctggtcagcacatc
ccaagacacaaggctgaatttagtcctgggcaggaagtatttcacagctgtgagcctggc
tgtggtgtcagggaggatgcttctctgcactgttcctcccagtgagagtggaaccgggca
gcccccagagtactggygcccatattctcatctgtgaaagcatgtgctgacttcctggac
ccactccttaatggacacatgctctttccacttcatttccaacttagcataaaagtatcc
ttcttttgcgatgaggggttccaattaaaaggcagctctgctagtcattgtgttttggtt
ggaatgaaaagcccttggaacagcagcattcctgtgtgtgaacagcagtgttcctatgag
tataaagaataa

KEGG   Bos indicus (zebu cattle): 109570214
Entry
109570214         CDS       T04792                                 

Definition
(RefSeq) membrane cofactor protein-like
  KO
K04007  membrane cofactor protein
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
biu05162  Measles
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109570214
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    109570214
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109570214
   04090 CD molecules [BR:biu04090]
    109570214
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   109570214
CD molecules [BR:biu04090]
 Proteins
  109570214
SSDB
Motif
Pfam: Sushi DUF4834 FAM163 SpoIIIAH Serinc V_ATPase_I MAP17 RNA_pol_Rpc4 Zip SID-1_RNA_chan Shisa Neur_chan_memb PA26 SARAF DUF2151 CLN3 SAPS Ureide_permease RXLR Peptidase_S49_N MLANA IgaA SpoIIP Ctr DUF262 Eapp_C RP-C_C TRAP_alpha DUF4407 SLC12 Nucleoside_tran DDHD
Other DBs
NCBI-GeneID: 109570214
NCBI-ProteinID: XP_019831549
Position
16
AA seq 678 aa
MTASCAPRQAPPARPESPPFPWCCVGMLLAALVLPLPIFSVRCIDPPVLDSMKLKGVIKR
HYYPGDRIDYECYRGYFYVWPYLLSATCEPNGSWSRIEEACLRKSCPDPQVKHGKVVAPN
DTFEWESEAHISCDEGYFLRGKPIIICNLIGENVSWSDTIPHCEKIYCGQPPKIKHGKHT
NSYRNIFEYNELITYSCDPSNGPDEYSLVGQNKLICIEPNKWSSDPPLCKVVKCQRPFLE
HGIMVSGSRDKFSYQSVVVFECLQGFYLNGSNLVFCGGNDTWEPEMPTCIKGYKPTHPTK
TPLSKYPGYPNPSDEIPSLEDFEDLDAGIIALAILTAIVAVVVVCTCLYRCLFSGKKEEK
DMKEKXKEVKEKEVRDXKEEEREKEEKQRKEEKEKEEKKEKERKEKEKERKEKEKEKKQK
EVFEEKILDEKIIPPPPGGALNVTTFNPXEKHAEGDLRTAERRGRKPQHAALEAEEGVET
DSLPVHLAGNVALPPPEATTTNTRFAVLCESSHRKAKTEGLSPLTAQQHNLGNSQIRTVG
VGPENRYSDGPLGDCDGKCEASKNQEERKRVRGPSARPSSLRLAVPDPCVGCGSTGILLR
SGRCLPGASRGGGAPRTNIRRRLNYASLSHSLSGFRKHPTCREGGKPLLRAFTGPFMLLC
PLLKSRMQIYPLRRQRII
NT seq 2037 nt   +upstreamnt  +downstreamnt
atgacagcgtcttgcgcgcctcgccaggcacctcccgctcgccccgagagtccccccttc
ccttggtgctgcgtcgggatgctcttggcggctctagtgctcccgttacccatattctcc
gtacgctgcattgatccaccagtattggacagtatgaagcttaagggtgtcattaagcgc
cactattatcctggggacagaatagactacgagtgttaccgaggatacttttatgtgtgg
ccttatctcctctcagccacttgtgagcctaatggctcatggagccgtatcgaagaagca
tgtttaagaaaatcatgtccagatccacaagtaaaacatggtaaagtagttgccccaaat
gacacatttgagtgggaatcagaagctcacatttcttgtgatgagggttatttcttaaga
ggaaaacctattataatttgtaaccttattggagagaatgtgtcttggagtgatacaatt
ccacactgtgaaaagatttattgtggacaacctccaaaaataaaacatggaaaacacacc
aatagctacaggaatatatttgaatataacgaattaataacttatagttgtgatccttca
aatggaccagatgaatattcacttgttggacagaacaagctaatttgtattgaacctaac
aaatggagtagtgaccctcctctrtgtaaagttgtcaaatgtcaacggccatttctcgaa
catggaataatggtgtcaggaagtagagacaaattttcgtaccagtcagtggtggtgttt
gagtgcctccagggtttttacctgaatggcagcaacctagtgttctgtggtggtaatgac
acttgggaacctgagatgccaacctgtattaaaggttacaagccaactcatccaacgaag
actccactttcaaaatatccaggataccccaatcccagtgacgaaataccatcacttgaa
gactttgaggatttagatgcaggaatcattgctctggctattcttactgcaattgttgct
gttgtagtagtttgcacgtgcctgtacagatgtcttttcagtgggaagaaggaagagaag
gatatgaaagagaaggyraaggaagtaaaggagaaggaagtgagggatrtgaaagaagag
gagagggagaaggaggagaagcagaggaaggaggagaaggagaaggaggagaagaaagag
aaggagaggaaggaaaaagagaaggagaggaaggagaaagagaaggagaagaagcagaag
gaagtctttgaagaaaagatcttggatgagaagattatccccccacccccaggtggggcc
ctaaatgtaaccacatttaatcctmacgagaagcatgcagagggagacctgagaacagca
gaaaggaggggccgcaagccacagcatgccgctctggaagctgaagaaggcgtggaaacg
gattcccttccagtacatcttgcggggaatgtggccctgcctccgcccgaagccactacg
acaaacaccaggtttgctgtactttgtgaaagcagccacagaaaagctaagacagagggg
ctctcgccgctgaccgcacagcagcataacctgggcaactcacaaatcagaactgtaggg
gtgggacctgaaaaccgctactctgacggccccttgggtgattgtgatgggaagtgtgaa
gcttccaaaaaccaagaggaaagaaagcgagtgcgtggtccttctgcaaggccctcctcc
ctgcgcctggcggttccggatccctgtgtcgggtgtggctccacagggatcctcctgagg
tctggcaggtgcctaccaggtgcaagcagaggtggcggggctcccaggaccaacatcaga
aggcggcttaactatgcttcsttaagccattctctttcaggtttccgcaaacacccaacc
tgtagagaggggggcaagccccttctgagagcgttcacaggtcccttcatgctgctgtgc
ccacttctgaaaagcagaatgcaaatatacccattgaggaggcaaaggatcatctaa

KEGG   Bos indicus (zebu cattle): 109570419
Entry
109570419         CDS       T04792                                 

Gene name
CD46
Definition
(RefSeq) membrane cofactor protein isoform X1
  KO
K04007  membrane cofactor protein
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
biu05162  Measles
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109570419 (CD46)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    109570419 (CD46)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109570419 (CD46)
   04090 CD molecules [BR:biu04090]
    109570419 (CD46)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   109570419 (CD46)
CD molecules [BR:biu04090]
 Proteins
  109570419 (CD46)
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 109570419
NCBI-ProteinID: XP_019831916
Position
16
AA seq 402 aa
MLLFSLFLDACDDPPRFVSMKPQGTLKPSYSPGEQIVYECHLGFQPXTPGQVLALVCQDN
NTWSSLQEGCKXRRCPTLADPTNGQVILVNGNTEFGSEVHYVCNNGYYLLGTXISYCEVS
SGXGVNWSDNPPTCEKILCQPPPEIQNGKYTNSHKDVFEYNEVVTYSCDPSNGPDEYSLV
GESKLTCIGNGEWSSXPPQCKVVKCVYPAIEYGTIVSGFGPKYYYKATVVLKCNEGFNLQ
GNSVVVCGENSTWEPELPKCIKVSIPPSTQSPIPSTQPPVPSVSVSTRSTQHPVPSVSVS
TRSTQHPIPNVSDSKPTSPTMTSGLSHPGHPPRPTDASPPNGAEGLGAGYIVLVIVAVLI
GVGLLLCLYCCFCGQRKKGKAECSATYTTYQDKATTATEQMN
NT seq 1209 nt   +upstreamnt  +downstreamnt
atgctcttattctctctattcctagatgcctgtgatgatccaccaagatttgtctctatg
aagccccagggtacccttaaacccagttatagtcctggggagcagattgtgtatgaatgt
catctgggtttccagccartaactcctggtcaagtcctggctctcgtttgtcaggataat
aatacatggtcgtctctccaggagggctgtaaaaraagacggtgtcctaccctagctgat
cccacaaatggccaagttatccttgtaaatggaaatactgagtttggctcagaggttcac
tatgtttgtaataatggttattacttactggggacaartatttcttattgtgaagtttct
tctggaamtggtgtgaactggagtgataatcctccaacatgtgaaaagattttgtgtcaa
ccrcctccagaaattcaaaatggaaaatacaccaatagccacaaggatgtatttgartac
aatgaagtagtaacttatagttgtgatccttcaaatgggccagatgaatattcccttgtt
ggagagagcaagcttacttgtattggaaatggtgaatggagtagtmaaccccctcagtgt
aaagtggtcaaatgtgtatatccagccattgaatatggaacgatagtctcaggatttgga
ccaaaatattactacaaagcgacggttgtacttaaatgcaatgagggttttaaccttcaa
ggcaacagygtagttgtctgtggtgagaacagtacttgggagcccgagctaccaaagtgt
attaaagtgtcgattcctcccagcacccagtctccaattcccagtacccaacctccagtt
cccagtgtctcagtgtcgactcgcagcacccaacatccagttcccagtgtctcagtgtcg
actcgcagcacccaacatccaattcccaatgtctcagattccaagcccacttctccaacc
atgacttcaggactaagtcatccaggacatcccccccgtcctactgatgcatcaccccct
aacggtgctgagggtttaggtgcaggatacatcgtgctcgtcattgttgctgtacttatt
ggcgttggattattgctctgcctgtactgctgtttttgcggacagaggaagaaagggaaa
gcagaatgtagcgctacgtacaccacttatcaggataaagcaaccactgcaacagaacag
atgaactga

DBGET integrated database retrieval system