KEGG   Bos indicus (zebu cattle): 109570254
Entry
109570254         CDS       T04792                                 

Gene name
SELE
Definition
(RefSeq) E-selectin
  KO
K06494  selectin, endothelial cell
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu04668  TNF signaling pathway
biu04933  AGE-RAGE signaling pathway in diabetic complications
biu05143  African trypanosomiasis
biu05144  Malaria
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    109570254 (SELE)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109570254 (SELE)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109570254 (SELE)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    109570254 (SELE)
  09174 Infectious disease: parasitic
   05144 Malaria
    109570254 (SELE)
   05143 African trypanosomiasis
    109570254 (SELE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:biu04515]
    109570254 (SELE)
   04090 CD molecules [BR:biu04090]
    109570254 (SELE)
   04091 Lectins [BR:biu04091]
    109570254 (SELE)
Cell adhesion molecules [BR:biu04515]
 Selectins
  Selectin family
   109570254 (SELE)
CD molecules [BR:biu04090]
 Proteins
  109570254 (SELE)
Lectins [BR:biu04091]
 C-Type lectins
  Group 4: Selectins
   109570254 (SELE)
SSDB
Motif
Pfam: Sushi Lectin_C EGF cEGF hEGF EGF_3 EGF_2
Other DBs
NCBI-GeneID: 109570254
NCBI-ProteinID: XP_019831591
Position
16
AA seq 485 aa
MIVSQYLSALTFVLLLFKESRTWSYHASTEMMTFEEARDYCQKTYTALVAIQNQEEIEYL
NSTFSYSPSYYWIGIRKINGTWTWIGTNKSLTKEATNWAPGEPNNKQSDEDCVEIYIKRE
KDSGKWNDEKCTKQKLALCYKAACNPTPCGSHGECVETINNYTCQCHPGFKGLKCEQVVT
CPAQKHPEHGHLVCNPLGKFTYNSSCSISCAEGYLPSSTEATRCMSSGEWSTPLPKCNVV
KCDALSNLDNGVVNCSPNHGSLPWNTTCTFECQEGYKLTGPQHLQCTSSGIWDNKQPTCK
AVSCAAISHPQNGTVNCSHSVVGDFAFKSSCHFTCAEGFTLQGPTQVECTAQGQWTQRVP
VCEVVRCSRLDVSGKLNMNCSGEPVLGTECTFACPERWTLNGSVVLTCGATGHWSGMLPT
CEAPTVSQTPLAVGLSTAGVSLVTIPSFLFWLLKRLQKKAKKFSPASSCSSLKSNGCYST
PSKLI
NT seq 1458 nt   +upstreamnt  +downstreamnt
atgattgtgtcacagtatctctctgctctcacttttgtgcttctcctgtttaaagaaagt
agaacctggtcttaccatgcatccacggaaatgatgacttttgaggaggccagagattat
tgccagaaaacttacacagctctagttgcaattcaaaaccaggaagagattgaatacctg
aactccacattcagctattcaccaagttactactggattggaatcagaaagatcaacggt
acatggacctggatagggacsaataagtccttgaccaaagaagccacaaactgggctcca
ggtgaaccaaacaataagcaaagtgatgaggactgtgtagagatctatattaagagagaa
aaagactcaggcaagtggaatgatgagaaatgyaccaaacagaaactcgccttgtgttac
aaagctgcctgtaaccccacaccctgcggcagccatggtgaatgtgtagagaccatcaac
aactacacttgtcagtgccaccctggcttcaagggcctcaaatgtgagcaagttgtgacc
tgtccagcacagaaacatcctgagcatggacatctggtttgcaaccctttggggaaattc
acctacaactcttcctgctccatcagctgtgcagagggctacctcccaagcagcacagag
gccactcggtgcatgtcctctggagaatggagcactcctctcccaaaatgcaatgtggtt
aagtgtgatgctttgtcaaatctggacaatggagtggtaaactgttccccaaaccatgga
agcctcccatggaacaccacctgtacgtttgagtgtcaggaaggatataaactcactgga
ccccagcacctacagtgtacctcctctgggatttgggacaacaagcagccaacatgtaaa
gctgtaagctgtgcagccatcagccatcctcagaacggcactgtgaactgtagccactcc
gtggttggagactttgccttcaagtcatcctgccacttcacctgtgcagagggcttcacg
ttgcaggggccaacccaggttgaatgcactgcccagggacaatggacacagcgggtccca
gtttgtgaagtggtacgatgttcacgtttggacgtttctggaaagctcaacatgaactgc
agtggggagcccgtgcttggcactgagtgtacgtttgcatgtcctgaaagatggacgctc
aatggctctgtagtgctgacctgyggtgctacaggacactggtctgggatgctgccaacc
tgtgaagctcccactgtgtcccaaactcccttggcagttggactttctactgctggagtc
tcccttgtgacaataccatcatttctcttctggcttctgaaacgccttcagaagaaagca
aaaaaattttctcctgccagcagctgctcaagcctgaaatccaatggatgctactcaaca
ccttccaagttaatttaa

DBGET integrated database retrieval system