KEGG   Bos indicus (zebu cattle): 109570286
Entry
109570286         CDS       T04792                                 

Gene name
AKT3
Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01521  EGFR tyrosine kinase inhibitor resistance
biu01522  Endocrine resistance
biu01524  Platinum drug resistance
biu04010  MAPK signaling pathway
biu04012  ErbB signaling pathway
biu04014  Ras signaling pathway
biu04015  Rap1 signaling pathway
biu04022  cGMP-PKG signaling pathway
biu04024  cAMP signaling pathway
biu04062  Chemokine signaling pathway
biu04066  HIF-1 signaling pathway
biu04068  FoxO signaling pathway
biu04071  Sphingolipid signaling pathway
biu04072  Phospholipase D signaling pathway
biu04140  Autophagy - animal
biu04150  mTOR signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04152  AMPK signaling pathway
biu04210  Apoptosis
biu04211  Longevity regulating pathway
biu04213  Longevity regulating pathway - multiple species
biu04218  Cellular senescence
biu04261  Adrenergic signaling in cardiomyocytes
biu04370  VEGF signaling pathway
biu04371  Apelin signaling pathway
biu04380  Osteoclast differentiation
biu04510  Focal adhesion
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04611  Platelet activation
biu04620  Toll-like receptor signaling pathway
biu04625  C-type lectin receptor signaling pathway
biu04630  JAK-STAT signaling pathway
biu04660  T cell receptor signaling pathway
biu04662  B cell receptor signaling pathway
biu04664  Fc epsilon RI signaling pathway
biu04666  Fc gamma R-mediated phagocytosis
biu04668  TNF signaling pathway
biu04722  Neurotrophin signaling pathway
biu04725  Cholinergic synapse
biu04728  Dopaminergic synapse
biu04910  Insulin signaling pathway
biu04914  Progesterone-mediated oocyte maturation
biu04915  Estrogen signaling pathway
biu04917  Prolactin signaling pathway
biu04919  Thyroid hormone signaling pathway
biu04920  Adipocytokine signaling pathway
biu04922  Glucagon signaling pathway
biu04923  Regulation of lipolysis in adipocytes
biu04926  Relaxin signaling pathway
biu04929  GnRH secretion
biu04931  Insulin resistance
biu04932  Non-alcoholic fatty liver disease
biu04933  AGE-RAGE signaling pathway in diabetic complications
biu04935  Growth hormone synthesis, secretion and action
biu04973  Carbohydrate digestion and absorption
biu05010  Alzheimer disease
biu05017  Spinocerebellar ataxia
biu05132  Salmonella infection
biu05135  Yersinia infection
biu05142  Chagas disease
biu05145  Toxoplasmosis
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05200  Pathways in cancer
biu05205  Proteoglycans in cancer
biu05210  Colorectal cancer
biu05211  Renal cell carcinoma
biu05212  Pancreatic cancer
biu05213  Endometrial cancer
biu05214  Glioma
biu05215  Prostate cancer
biu05218  Melanoma
biu05220  Chronic myeloid leukemia
biu05221  Acute myeloid leukemia
biu05222  Small cell lung cancer
biu05223  Non-small cell lung cancer
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
biu05230  Central carbon metabolism in cancer
biu05231  Choline metabolism in cancer
biu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109570286 (AKT3)
   04012 ErbB signaling pathway
    109570286 (AKT3)
   04014 Ras signaling pathway
    109570286 (AKT3)
   04015 Rap1 signaling pathway
    109570286 (AKT3)
   04370 VEGF signaling pathway
    109570286 (AKT3)
   04371 Apelin signaling pathway
    109570286 (AKT3)
   04630 JAK-STAT signaling pathway
    109570286 (AKT3)
   04668 TNF signaling pathway
    109570286 (AKT3)
   04066 HIF-1 signaling pathway
    109570286 (AKT3)
   04068 FoxO signaling pathway
    109570286 (AKT3)
   04072 Phospholipase D signaling pathway
    109570286 (AKT3)
   04071 Sphingolipid signaling pathway
    109570286 (AKT3)
   04024 cAMP signaling pathway
    109570286 (AKT3)
   04022 cGMP-PKG signaling pathway
    109570286 (AKT3)
   04151 PI3K-Akt signaling pathway
    109570286 (AKT3)
   04152 AMPK signaling pathway
    109570286 (AKT3)
   04150 mTOR signaling pathway
    109570286 (AKT3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109570286 (AKT3)
  09143 Cell growth and death
   04210 Apoptosis
    109570286 (AKT3)
   04218 Cellular senescence
    109570286 (AKT3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109570286 (AKT3)
   04550 Signaling pathways regulating pluripotency of stem cells
    109570286 (AKT3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109570286 (AKT3)
   04620 Toll-like receptor signaling pathway
    109570286 (AKT3)
   04625 C-type lectin receptor signaling pathway
    109570286 (AKT3)
   04660 T cell receptor signaling pathway
    109570286 (AKT3)
   04662 B cell receptor signaling pathway
    109570286 (AKT3)
   04664 Fc epsilon RI signaling pathway
    109570286 (AKT3)
   04666 Fc gamma R-mediated phagocytosis
    109570286 (AKT3)
   04062 Chemokine signaling pathway
    109570286 (AKT3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109570286 (AKT3)
   04922 Glucagon signaling pathway
    109570286 (AKT3)
   04923 Regulation of lipolysis in adipocytes
    109570286 (AKT3)
   04920 Adipocytokine signaling pathway
    109570286 (AKT3)
   04929 GnRH secretion
    109570286 (AKT3)
   04915 Estrogen signaling pathway
    109570286 (AKT3)
   04914 Progesterone-mediated oocyte maturation
    109570286 (AKT3)
   04917 Prolactin signaling pathway
    109570286 (AKT3)
   04926 Relaxin signaling pathway
    109570286 (AKT3)
   04935 Growth hormone synthesis, secretion and action
    109570286 (AKT3)
   04919 Thyroid hormone signaling pathway
    109570286 (AKT3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109570286 (AKT3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    109570286 (AKT3)
  09156 Nervous system
   04725 Cholinergic synapse
    109570286 (AKT3)
   04728 Dopaminergic synapse
    109570286 (AKT3)
   04722 Neurotrophin signaling pathway
    109570286 (AKT3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109570286 (AKT3)
  09149 Aging
   04211 Longevity regulating pathway
    109570286 (AKT3)
   04213 Longevity regulating pathway - multiple species
    109570286 (AKT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109570286 (AKT3)
   05205 Proteoglycans in cancer
    109570286 (AKT3)
   05230 Central carbon metabolism in cancer
    109570286 (AKT3)
   05231 Choline metabolism in cancer
    109570286 (AKT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109570286 (AKT3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109570286 (AKT3)
   05212 Pancreatic cancer
    109570286 (AKT3)
   05225 Hepatocellular carcinoma
    109570286 (AKT3)
   05226 Gastric cancer
    109570286 (AKT3)
   05214 Glioma
    109570286 (AKT3)
   05221 Acute myeloid leukemia
    109570286 (AKT3)
   05220 Chronic myeloid leukemia
    109570286 (AKT3)
   05218 Melanoma
    109570286 (AKT3)
   05211 Renal cell carcinoma
    109570286 (AKT3)
   05215 Prostate cancer
    109570286 (AKT3)
   05213 Endometrial cancer
    109570286 (AKT3)
   05224 Breast cancer
    109570286 (AKT3)
   05222 Small cell lung cancer
    109570286 (AKT3)
   05223 Non-small cell lung cancer
    109570286 (AKT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109570286 (AKT3)
   05017 Spinocerebellar ataxia
    109570286 (AKT3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109570286 (AKT3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    109570286 (AKT3)
   04931 Insulin resistance
    109570286 (AKT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    109570286 (AKT3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109570286 (AKT3)
   05135 Yersinia infection
    109570286 (AKT3)
   05152 Tuberculosis
    109570286 (AKT3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109570286 (AKT3)
   05170 Human immunodeficiency virus 1 infection
    109570286 (AKT3)
   05162 Measles
    109570286 (AKT3)
   05164 Influenza A
    109570286 (AKT3)
   05161 Hepatitis B
    109570286 (AKT3)
   05160 Hepatitis C
    109570286 (AKT3)
   05168 Herpes simplex virus 1 infection
    109570286 (AKT3)
   05163 Human cytomegalovirus infection
    109570286 (AKT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109570286 (AKT3)
   05169 Epstein-Barr virus infection
    109570286 (AKT3)
   05165 Human papillomavirus infection
    109570286 (AKT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109570286 (AKT3)
   05142 Chagas disease
    109570286 (AKT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109570286 (AKT3)
   01524 Platinum drug resistance
    109570286 (AKT3)
   01522 Endocrine resistance
    109570286 (AKT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:biu01001]
    109570286 (AKT3)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109570286 (AKT3)
Protein kinases [BR:biu01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   109570286 (AKT3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like FTA2 PH_11
Other DBs
NCBI-GeneID: 109570286
NCBI-ProteinID: XP_019831660
Position
16
AA seq 479 aa
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCMDNERRPHFPQFSYSASGRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgagcgatgttaccattgtgaaagaaggttgggttcagaagaggggagaatatataaaa
aactggaggccaagatatttccttttgaagacagatggctcattcataggatataaagag
aaaccccaagatgtggatttaccttatcccctcaacaacttttcagtagcaaaatgccag
ttaatgaaaacagaacgaccaaagccaaacacatttattatcagatgtctccagtggacc
actgttatagagagaacatttcacgtagatactccagaggaaagggaagaatggacagaa
gctatccaggctgtagcagacagactccagaggcaagaagaagagagaatgaattgtagt
ccaacttcacaaattgataatataggagaggaagagatggatgcttctacaacccatcat
aaaagaaagacaatgaatgattttgactatttgaaactactaggtaaaggcacttttggg
aaagttattttggttcgagagaaggcaagtggaaaatattatgctatgaagattctgaag
aaagaagttattattgccaaggatgaagtggcgcacactttaactgaaagcagagtatta
aagaacactagacatccctttttaacatccctgaaatattccttccagacaaaagaccgt
ttatgttttgtgatggaatatgttaatgggggagagctgtttttccatttgtcgagagag
cgggtgttctccgaggaccgcacacgtttctatggtgcagaaattgtctctgccttggac
tatctacattccggaaagattgtgtaccgtgatctcaagttggagaatttgatgctggat
aaagatggccacataaaaatcacagattttggactttgcaaagaagggatcactgatgca
gccaccatgaagactttctgtggtacaccagagtatctggcaccagaggtgttagaagat
aatgactatggccgagctgtggattggtggggccttggggttgtcatgtatgaaatgatg
tgcgggagattacctttctataaccaggatcatgagaaactttttgaactaattctaatg
gaagatattaaatttcctcgaacactctcttcagatgcaaaatcattgctttcaggcctc
ttgataaaggatccaaataaacgccttggtggaggaccagatgatgcaaaagaaattatg
agacacagtttcttttctggagtaaactggcaagatgtgtatgataaaaagcttgtacct
ccttttaagcctcaagtaacatctgagacagacaccagatattttgatgaagaatttaca
gctcagactattacaataacaccacctgaaaaatatgatgaggacggtatggactgcatg
gacaatgagaggcggccgcacttccctcagttttcctactctgcaagtggacgagaataa

KEGG   Bos indicus (zebu cattle): 109572496
Entry
109572496         CDS       T04792                                 

Gene name
AKT2
Definition
(RefSeq) RAC-beta serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01521  EGFR tyrosine kinase inhibitor resistance
biu01522  Endocrine resistance
biu01524  Platinum drug resistance
biu04010  MAPK signaling pathway
biu04012  ErbB signaling pathway
biu04014  Ras signaling pathway
biu04015  Rap1 signaling pathway
biu04022  cGMP-PKG signaling pathway
biu04024  cAMP signaling pathway
biu04062  Chemokine signaling pathway
biu04066  HIF-1 signaling pathway
biu04068  FoxO signaling pathway
biu04071  Sphingolipid signaling pathway
biu04072  Phospholipase D signaling pathway
biu04140  Autophagy - animal
biu04150  mTOR signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04152  AMPK signaling pathway
biu04210  Apoptosis
biu04211  Longevity regulating pathway
biu04213  Longevity regulating pathway - multiple species
biu04218  Cellular senescence
biu04261  Adrenergic signaling in cardiomyocytes
biu04370  VEGF signaling pathway
biu04371  Apelin signaling pathway
biu04380  Osteoclast differentiation
biu04510  Focal adhesion
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04611  Platelet activation
biu04620  Toll-like receptor signaling pathway
biu04625  C-type lectin receptor signaling pathway
biu04630  JAK-STAT signaling pathway
biu04660  T cell receptor signaling pathway
biu04662  B cell receptor signaling pathway
biu04664  Fc epsilon RI signaling pathway
biu04666  Fc gamma R-mediated phagocytosis
biu04668  TNF signaling pathway
biu04722  Neurotrophin signaling pathway
biu04725  Cholinergic synapse
biu04728  Dopaminergic synapse
biu04910  Insulin signaling pathway
biu04914  Progesterone-mediated oocyte maturation
biu04915  Estrogen signaling pathway
biu04917  Prolactin signaling pathway
biu04919  Thyroid hormone signaling pathway
biu04920  Adipocytokine signaling pathway
biu04922  Glucagon signaling pathway
biu04923  Regulation of lipolysis in adipocytes
biu04926  Relaxin signaling pathway
biu04929  GnRH secretion
biu04931  Insulin resistance
biu04932  Non-alcoholic fatty liver disease
biu04933  AGE-RAGE signaling pathway in diabetic complications
biu04935  Growth hormone synthesis, secretion and action
biu04973  Carbohydrate digestion and absorption
biu05010  Alzheimer disease
biu05017  Spinocerebellar ataxia
biu05132  Salmonella infection
biu05135  Yersinia infection
biu05142  Chagas disease
biu05145  Toxoplasmosis
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05200  Pathways in cancer
biu05205  Proteoglycans in cancer
biu05210  Colorectal cancer
biu05211  Renal cell carcinoma
biu05212  Pancreatic cancer
biu05213  Endometrial cancer
biu05214  Glioma
biu05215  Prostate cancer
biu05218  Melanoma
biu05220  Chronic myeloid leukemia
biu05221  Acute myeloid leukemia
biu05222  Small cell lung cancer
biu05223  Non-small cell lung cancer
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
biu05230  Central carbon metabolism in cancer
biu05231  Choline metabolism in cancer
biu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109572496 (AKT2)
   04012 ErbB signaling pathway
    109572496 (AKT2)
   04014 Ras signaling pathway
    109572496 (AKT2)
   04015 Rap1 signaling pathway
    109572496 (AKT2)
   04370 VEGF signaling pathway
    109572496 (AKT2)
   04371 Apelin signaling pathway
    109572496 (AKT2)
   04630 JAK-STAT signaling pathway
    109572496 (AKT2)
   04668 TNF signaling pathway
    109572496 (AKT2)
   04066 HIF-1 signaling pathway
    109572496 (AKT2)
   04068 FoxO signaling pathway
    109572496 (AKT2)
   04072 Phospholipase D signaling pathway
    109572496 (AKT2)
   04071 Sphingolipid signaling pathway
    109572496 (AKT2)
   04024 cAMP signaling pathway
    109572496 (AKT2)
   04022 cGMP-PKG signaling pathway
    109572496 (AKT2)
   04151 PI3K-Akt signaling pathway
    109572496 (AKT2)
   04152 AMPK signaling pathway
    109572496 (AKT2)
   04150 mTOR signaling pathway
    109572496 (AKT2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109572496 (AKT2)
  09143 Cell growth and death
   04210 Apoptosis
    109572496 (AKT2)
   04218 Cellular senescence
    109572496 (AKT2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109572496 (AKT2)
   04550 Signaling pathways regulating pluripotency of stem cells
    109572496 (AKT2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109572496 (AKT2)
   04620 Toll-like receptor signaling pathway
    109572496 (AKT2)
   04625 C-type lectin receptor signaling pathway
    109572496 (AKT2)
   04660 T cell receptor signaling pathway
    109572496 (AKT2)
   04662 B cell receptor signaling pathway
    109572496 (AKT2)
   04664 Fc epsilon RI signaling pathway
    109572496 (AKT2)
   04666 Fc gamma R-mediated phagocytosis
    109572496 (AKT2)
   04062 Chemokine signaling pathway
    109572496 (AKT2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109572496 (AKT2)
   04922 Glucagon signaling pathway
    109572496 (AKT2)
   04923 Regulation of lipolysis in adipocytes
    109572496 (AKT2)
   04920 Adipocytokine signaling pathway
    109572496 (AKT2)
   04929 GnRH secretion
    109572496 (AKT2)
   04915 Estrogen signaling pathway
    109572496 (AKT2)
   04914 Progesterone-mediated oocyte maturation
    109572496 (AKT2)
   04917 Prolactin signaling pathway
    109572496 (AKT2)
   04926 Relaxin signaling pathway
    109572496 (AKT2)
   04935 Growth hormone synthesis, secretion and action
    109572496 (AKT2)
   04919 Thyroid hormone signaling pathway
    109572496 (AKT2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109572496 (AKT2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    109572496 (AKT2)
  09156 Nervous system
   04725 Cholinergic synapse
    109572496 (AKT2)
   04728 Dopaminergic synapse
    109572496 (AKT2)
   04722 Neurotrophin signaling pathway
    109572496 (AKT2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109572496 (AKT2)
  09149 Aging
   04211 Longevity regulating pathway
    109572496 (AKT2)
   04213 Longevity regulating pathway - multiple species
    109572496 (AKT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109572496 (AKT2)
   05205 Proteoglycans in cancer
    109572496 (AKT2)
   05230 Central carbon metabolism in cancer
    109572496 (AKT2)
   05231 Choline metabolism in cancer
    109572496 (AKT2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109572496 (AKT2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109572496 (AKT2)
   05212 Pancreatic cancer
    109572496 (AKT2)
   05225 Hepatocellular carcinoma
    109572496 (AKT2)
   05226 Gastric cancer
    109572496 (AKT2)
   05214 Glioma
    109572496 (AKT2)
   05221 Acute myeloid leukemia
    109572496 (AKT2)
   05220 Chronic myeloid leukemia
    109572496 (AKT2)
   05218 Melanoma
    109572496 (AKT2)
   05211 Renal cell carcinoma
    109572496 (AKT2)
   05215 Prostate cancer
    109572496 (AKT2)
   05213 Endometrial cancer
    109572496 (AKT2)
   05224 Breast cancer
    109572496 (AKT2)
   05222 Small cell lung cancer
    109572496 (AKT2)
   05223 Non-small cell lung cancer
    109572496 (AKT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109572496 (AKT2)
   05017 Spinocerebellar ataxia
    109572496 (AKT2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109572496 (AKT2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    109572496 (AKT2)
   04931 Insulin resistance
    109572496 (AKT2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    109572496 (AKT2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109572496 (AKT2)
   05135 Yersinia infection
    109572496 (AKT2)
   05152 Tuberculosis
    109572496 (AKT2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109572496 (AKT2)
   05170 Human immunodeficiency virus 1 infection
    109572496 (AKT2)
   05162 Measles
    109572496 (AKT2)
   05164 Influenza A
    109572496 (AKT2)
   05161 Hepatitis B
    109572496 (AKT2)
   05160 Hepatitis C
    109572496 (AKT2)
   05168 Herpes simplex virus 1 infection
    109572496 (AKT2)
   05163 Human cytomegalovirus infection
    109572496 (AKT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109572496 (AKT2)
   05169 Epstein-Barr virus infection
    109572496 (AKT2)
   05165 Human papillomavirus infection
    109572496 (AKT2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109572496 (AKT2)
   05142 Chagas disease
    109572496 (AKT2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109572496 (AKT2)
   01524 Platinum drug resistance
    109572496 (AKT2)
   01522 Endocrine resistance
    109572496 (AKT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:biu01001]
    109572496 (AKT2)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109572496 (AKT2)
Protein kinases [BR:biu01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   109572496 (AKT2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C
Other DBs
NCBI-GeneID: 109572496
NCBI-ProteinID: XP_019834891
Position
18
AA seq 481 aa
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRGPGDDPM
DYKCGSPSDSSAAEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQK
KLLPPFKPQVTSEVDTRYFDDEFTAQSITVTPPDRYDSLGSLELDQRTHFPQFSYSASIR
E
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgaacgaggtgtctgtcatcaaagaaggctggctccataagcgcggtgaatatatcaag
acctggcggccccggtacttcctgctgaagagcgacggctccttcattggctataaggag
cggcctgaggcccccgaccagaccctgccccccttaaacaacttctctgtcgcagaatgc
cagctgatgaagaccgagagacctcggcccaataccttcgtcattcgctgtctgcagtgg
accacagtcatcgagaggaccttccatgttgactccccagacgagagggaagagtggatg
cgggccatccagatggttgccaacagcctcaagcagaggggtccaggggacgaccccatg
gactacaagtgtggctcccccagcgactcttctgcggccgaggagatggaggtggcagtt
agcaaggcgcgggccaaggtgaccatgaatgacttcgactatctcaaactcctgggcaaa
ggcacctttggcaaggtcatcctggtgcgggagaaggccactggccgctactatgccatg
aagatcctgcggaaggaggtgatcatcgccaaggatgaagtcgcccacacggtcaccgag
agccgggtcctgcagaacaccaggcacccgttcctcaccgcgctgaagtacgccttccag
acacacgaccgcctgtgcttcgtgatggagtacgccaacggcggcgagctgttcttccac
ttgtcccgggagcgtgtcttcacagaggagcgggcccgcttttatggagcagagatcgtc
tcagccctggagtacctgcactcgcgggacgtggtgtaccgcgacatcaagctggaaaac
ctcatgctggacaaggacggscacatcaagatcactgacttcggcctgtgcaaggagggc
atcagcgacggggccaccatgaagaccttttgtgggacccctgagtacctggcgcccgag
gtgctggaggacaacgactayggccgggcggtggactggtgggggctgggtgtggtcatg
tacgagatgatgtgcggccgcctgcccttctacaaccaggatcacgagcgcctcttcgag
ctcatyctcatggaggagatccgcttcccgcgcacgctcagccctgaggccaagtccctg
cttgctgggctgcttaagaaggaccctaagcagaggctcggcggagggcccagtgacgcc
aaggaggtcatggagcacaggttcttccttagtatcaactggcaggacgtggtccagaag
aagctcctgccacccttcaagcctcaggtcacgtctgaggtcgacacaaggtactttgac
gacgagttcaccgcccagtccatcacagtcacgcccccggaccgctatgacagcctgggc
tcactggagctggaccagcggacgcacttcccccagttctcctattcggccagcatccga
gagtga

DBGET integrated database retrieval system