KEGG   Bos indicus (zebu cattle): 109570348Help
Entry
109570348         CDS       T04792                                 

Gene name
PIK3C2B
Definition
(RefSeq) phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta
  KO
K00923  phosphatidylinositol-4-phosphate 3-kinase [EC:2.7.1.154]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu00562  Inositol phosphate metabolism
biu01100  Metabolic pathways
biu04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:biu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    109570348 (PIK3C2B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    109570348 (PIK3C2B)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.154  phosphatidylinositol-4-phosphate 3-kinase
     109570348 (PIK3C2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_C2 PI3K_rbd PX C2 DUF4135 HEAT_2
Motif
Other DBs
NCBI-GeneID: 109570348
NCBI-ProteinID: XP_019831787
Position
16
AA seq 1617 aa AA seqDB search
MSSTQGSGEHWKSLESVGISRKELAMAEALQMEYDALSRLRHDKEESRAKQNADPSLIGW
DEPVLDFYSKPAGRRKDLKLLRGLSGSDPTLNYNSVSPQEGLPNHSTSRGSQPGPDPWPK
GSLAEDYLYIFDGSDGGLSLSPGPRHREDSSKKLSPPPLPPRVSIWDTPPLPPRKGSPSS
SKVSQPSDINTFSSVEQPPGKLLGPGILEEEEELGGGSPGRPLGSVDYDGINDAITRLNL
KSTYDAEMLRDATRGWKEGRGPLDFAKDTPGKPVARSKTMPPQVPPRTYASRCANRKNAT
PGKNRRISAAPVGSRPHTVANGHELFEVSEERDEEVAAFCHMLDVLRSGSDVQDYALTGY
VWSAVTPSPEHLGDEVNLKVTVLCDSLREPLTFTCNCSSTVDLLIYQTLCYTRDELRDVD
VGDFVLKPCGLEEFLQNKHALGSHEYIQYCRKFGIDIRLQLMEQKAVRGDLARTVNDDQS
PSTLNYLVHLQERPVKQTISRQALSLLFDTYHNEVDAFLLADGDFPLKADRVVQSVKAIC
NALAAVETPEITSALNQLPPCPSRVKPKIQKDPTVLAMKENREKVVEALTAAILDLVELY
CNTFNADFQPAVPGSRKHTLVQEACHLSGPLAFTVYATHRIPITWATSYEEFYLSCSLSH
GGKELCSPLQTRRVHFSKYLFHLVIWDQQICFPVQLNRLPRETLLCATLYALPVPPPGSS
SEANKQRRVPEALGWVTAPLFNFRQVLTCGRKLLGLWPATQESPSARWSAPNFHQPDSVI
LQIDFPTSAFDIKFTSPAGDKFSPRYEFGSLREEDQHVLKNIMQKESLHWLTDADKKRLW
EKRYYCHAEVSALPLVLASAPSWEWACLPDTYALLAQWTPMNHQDALGLLHATFPDQEVR
RMAVQWIGSLSDAELLDYLPQLVQALKYECYLDSPLVRFLLKRAVSDLRVTHYFFWLLKD
GLKDSQFSIRYQYLLAALLCCCGKGLREEFNRQCWLVNTLAKLAQQVREAAPSARQVRRA
RLPLPHSGSGPLQPIDCSYFNSNAVPLKLSFQNVDPLGENIRVIFKCGDDLRQDMLTLQM
IRIMSKIWVQEGLDMRMVIFRCFSTVRGRGMVEMIPNSETLRKIQVEHGVTGSFKDRPLA
DWLQKHNPGEDEYEKAVENFIYSCAGCCVATYVLGICDRHNDNIMLKTTGHMFHIDFGRF
LGHAQMFGNIKRDRAPFVFTSDMAYVINGGDKPSSRFHDFVDLCCQAYNLIRKHTHLFLN
LLGLMLSCGIPELSDLEDLKYVYDALRPQDTEANATTYFTRLIESSLGSVATKLNFFIHN
LAQMKFLGSDDRLTLSFAPRTHTLKSSGRISDVFLCRHEKVFHPNKGYIYVVKVMRENAH
EAAYIQRTFEEFQELHNKLRLLFPSSLLPSFPSRFVIGRSRGEAGAERRREELNGYIWHL
VHAAPEVAECDLVYTFFHPLPRDEKTAGSSLAPKSSEGTWARPVGRVGGEVKLSISYKNN
KLFIMVMHIRGLQLLQDGNDPDPYVKIYLLPDPQKTTKKKTKVARKTCNPTYNEMLVYDG
IPKGDLQQRELQLSVLSEQGFWENVLLGEVHIRLRELDLAQEKTGWFALGSRSPETL
NT seq 4854 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcgactcagggcagtggggaacactggaagtccctggagtcggtgggcatcagc
cgcaaagaactggccatggctgaagccttgcagatggagtacgacgcgctgtcccgrctt
cggcacgacaaggaggaaagcagggcaaagcagaacgcagacccctctctgatcggctgg
gatgagcctgttctggacttctacagcaagccagcgggaaggcggaaggacctcaagctc
ttacgcggtctttctggctccgatcctaccctcaattacaactcagtctccccacaggaa
gggctgcccaaccactctacctcccggggctcccagcctggcccagatccctggcccaaa
ggctccctggccgaagactatctctacatttttgatggttcagatggggggctctccttg
tccccaggaccaaggcacagagaagactcttctaagaaactgtccccgcctcctctgcct
ccccgagtctctatctgggatactcctcccctgcctcccagaaaggggtccccctcctct
tccaaggtttcccagcccagtgacatcaacactttctcttcagttgaacaacctccaggc
aagttgctggggcccgggatcctagaagaggaggaggagctgggaggtgggagtccgggg
cggccgctgggttccgtggactacgacggcattaacgatgccatcacacggctgaacctg
aagtcgacctacgacgcagagatgctgcgggatgccaccaggggctggaaggagggtcgg
gggcccctggactttgccaaggacactcctgggaagcccgtggcccggagcaagaccatg
cccccacaggtgcccccccgcacatacgcctcccgctgcgccaaccggaaaaacgcaaca
cccggcaagaaccgccgcatttctgcagccccggtgggctcccggccccacaccgtcgcc
aatggccacgagctgtttgaggtctcagaggagagagatgaggaagttgctgcattttgc
cacatgctggatgtcctccgatccggctctgatgtccaggactacgccctcactgggtat
gtctggagcgctgtcaccccgagcccggagcacctcggggacgaggtgaacctgaaggtg
accgtgctgtgcgacagcctgcgggagccgctcacttttacctgcaactgctcctccact
gtagacttgctcatctaccagaccctgtgctacacccgtgatgaactgagggatgtcgac
gtgggtgactttgtgctgaagccctgtgggctggaggagttcctgcagaacaagcacgcc
ctgggcagccacgagtatattcagtactgtcggaagttcggcatcgatatccggctgcag
ctgatggagcagaaggccgtgcgcggtgacctggcccgcacggtgaatgatgaccagagc
ccctccaccttgaactacctcgtccacctgcaagagaggccagtcaagcagaccatcagc
aggcaggccctgagtcttctgttcgacacttaccacaatgaggtggatgccttcctgttg
gctgacggggacttcccactgaaggccgacagggtggtccagtccgtcaaggccatctgc
aacgccctagccgctgtggaaacccctgagatcaccagcgctctcaaccagctgcccccc
tgcccttcccgagtgaagcctaaaatccagaaggatcccaccgtcttggccatgaaggaa
aaccgagagaaggttgtggaagccctgacggctgccatcttggacctggtggagctgtac
tgcaacacgttcaacgcagacttccagcccgcggtgcctgggagccgcaagcacaccctg
gttcaggaggcctgccatctctcggggccgctggccttcacggtctatgccacccaccgc
atcccgatcacctgggctaccagctatgaagagttctacctctcctgctccctcagccac
ggcggcaaggagctgtgcagccccctgcagacccgacgggtccacttctccaagtacctc
ttccacctcgtcatctgggaccagcagatctgcttccctgtgcagctgaaccggctgcct
cgggagaccctgctgtgtgccaccctctacgctctgcccgtgcccccgccggggagctcc
tcggaggccaacaagcagcggcgggtgcccgaagccctgggctgggtcactgctccgctc
ttcaacttcaggcaagtcctgacctgtggccggaagcttctgggcttatggccagcaaca
caggaaagtcccagtgcccgctggagtgcacctaatttccatcagccagatagtgtgatc
ctgcagattgactttcccacctcggcctttgacatcaagttcaccagccctgctggagac
aagttcagcccccgctatgagtttggcagcctccgggaggaagaccaacatgtgcttaaa
aacatcatgcagaaggaatccctgcactggctcacggatgccgacaaaaagcgcctgtgg
gagaagcggtattactgccacgcggaggtgagcgcgctgccgctggtgcttgccagcgcg
cccagctgggagtgggcgtgcctccccgacacctatgctctgctggcgcagtggaccccy
atgaaccaccaggacgccctggggctcctgcacgccacgtttccagaccaggaggtgcgt
cgcatggctgtacagtggatcggctccctctccgatgccgagctgctggactacttgccc
cagctcgtgcaggccttaaagtatgaatgctacctggacagccccttggtgcgcttcctc
ctgaagcgagcggtctctgacttgagagtgactcactacttcttctggttgctgaaggac
ggcctcaaagactctcagttcagcatccgctaccagtacctgctggccgccttgttgtgt
tgctgtggcaaggggctgagagaggagtttaaccgccagtgctggcttgttaataccctg
gccaaactggcccagcaggtccgggaggctgccccgtctgcacggcaggtgaggagggcg
aggctgcctctgccccattctggttctgggcctctgcagccaattgactgttcctacttc
aactccaacgccgttcccctcaagctctccttccaaaacgtggacccactgggcgagaac
atccgtgtcatcttcaagtgtggggacgaccttcgccaggacatgctgaccctgcagatg
atccgcatcatgagcaagatctgggtccaggagggcctggacatgcgcatggtcatcttc
cgctgcttctccaccgtccgggggagagggatggtggagatgatccccaactctgagacc
ctgcgcaagatccaggtggagcayggggtgaccggttcctttaaggaccggcccctcgcc
gactggctgcagaagcacaaccctggggaggacgagtatgagaaggctgtagagaacttc
atctactcctgtgccggctgctgtgtggccacctacgtcctgggcatctgtgaccgacac
aaygacaacatcatgctgaagacgactggccacatgttccacatagatttcggccgcttc
ctgggccatgcccagatgttcggcaacatcaagcgggaccgcgccccctttgtcttcacc
tcggacatggcgtatgtcatcaacgggggtgacaagccttccagccgcttccatgatttt
gttgacctttgctgccaagcctacaacctcattcgcaagcacacccacctcttcctcaac
cttctgggcctgatgttgtcctgtgggatccctgaactctcagacctggaagacctcaag
tacgtgtacgatgccctgaggcctcaggacacggaggccaacgccactacctacttcacc
aggttgatagagtccagccttggcagtgtagccacaaagctcaatttttttattcataac
ctggctcagatgaagtttttaggctcagatgatcggctgaccctctcctttgctccacga
acacacactctcaagagctcaggccgcataagcgatgtgtttctctgtcgccacgagaag
gtcttccaccccaacaagggctatatttacgtggtaaaggtgatgcgagagaatgctcac
gaggccgcttacatccagcggacatttgaggagttccaggagttacacaataagctgcgg
ctgctcttcccttcttccctcttgcccagcttccccagtcgcttcgtgattggccgctcg
cgaggagaggcaggggccgagcggcgccgggaggagctaaacggatacatctggcacttg
gtccacgcggccccggaggtggccgagtgtgatttggtgtacaccttcttccaccccctg
cccagggatgagaagacggcaggcagcagcctggctcccaagtcctcagaaggcacatgg
gcccggccagtcgggagggttggaggagaggtgaaactgtccatctcctacaaaaacaat
aaactcttcatcatggtgatgcacattcggggcttgcaactgctccaggatgggaatgat
cccgacccctatgtcaagatttacctccttcctgaccctcagaaaaccactaagaagaaa
accaaagtggcccggaaaacctgcaaccccacctacaatgagatgctggtgtatgatgga
atccccaagggcgacctgcagcagcgggagctgcagctgagtgtgctgagtgagcaaggg
ttctgggagaacgtgctcctcggggaagtgcacatccgcctgcgagagctggacctggcc
caggagaagactggctggtttgcactgggatctcgaagtcctgagaccttatga

DBGET integrated database retrieval system