KEGG   Bos indicus (zebu cattle): 109570366
Entry
109570366         CDS       T04792                                 

Gene name
DFFB
Definition
(RefSeq) DNA fragmentation factor subunit beta isoform X1
  KO
K02311  DNA fragmentation factor, 40 kD, beta subunit [EC:3.-.-.-]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109570366 (DFFB)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.-  
   3.-.-  
    3.-.-.-  
     109570366 (DFFB)
SSDB
Motif
Pfam: DFF40 CIDE-N Peptidase_M24
Other DBs
NCBI-GeneID: 109570366
NCBI-ProteinID: XP_019831815
Position
16
AA seq 341 aa
MSAVLRKPKTFKLRSLHSEKKFGVAGRSCEEVLRKGCQRLQLPIPGSRLCLYEDGTELTG
DYFWSAPDNSELVLLTAGQNWQGFVSDISRFLSVFQEPHAGVIQAARQLLWDERAPLRQK
LLADLLGTVSENIAAETRAEDPPWFEGLESRFRSKSGYLRYSCESRIRSYLREVTSGASL
VGAEAREEYLRLVGSMQQKLQAAQYNSSYFDRGAKAGRRLCTPEGWFSCQGPFDVDDCTS
RHSINPYSNRESRVLFSTWNLDHVIEKKRVVVPALAAAVHDAEGREVDWEYFYRLLFTLE
NLKLVHIACHKKTTHKLHCDPSRVYCTPAAPRRKRHARQRL
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgtcggcggtgctccggaagcccaagacgttcaagctgcggtccctgcatagcgagaag
aagtttggggtggcgggcaggagctgcgaggaagtgctgcggaaggggtgccaacgcttg
cagctccccatccctggttcccgcctgtgtctctatgaggatggcacggaattgactgga
gattacttctggagtgcccccgacaactcagagcttgtgcttctcactgccggccagaac
tggcagggcttcgtgagtgacatcagccgcttcctgagcgtgttccaggagccgcacgca
ggtgtcatccaggccgcccggcagctgctctgggacgagcgggccccactgcggcagaag
ctgctggccgacctgctgggcaccgtcagtgagaacatcgcggccgagaccagggccgag
gacccgccgtggtttgaaggcttggagtcccggtttaggagcaagtctggctatctgaga
tacagctgcgagagccggatccggagctacctgagagaagtgacctctggcgcctccctg
gtgggcgcagaggctcgtgaggagtacctgcggctcgtgggctccatgcagcagaagctc
caggctgcccagtacaacagcagctacttcgaccgaggggcgaaggccggccgccggctc
tgcacccccgaaggctggttctcctgccagggtccttttgacgtggacgactgtacctcc
agacactccatcaacccctacagtaaccgggagagccgtgtcctcttcagcacctggaac
ctggaccatgtaatagaaaagaagcgtgtggtcgtgcccgcgctggccgcggccgtccac
gatgcggaagggagagaggtggactgggagtacttctaccgcctgctcttcaccttggag
aacctcaagttagtccacattgcctgccacaagaagaccacccacaaactccactgtgac
cccagcagggtctactgcaccccagcagcaccgcggaggaagcggcatgcccgccagcgc
ctgtga

DBGET integrated database retrieval system