KEGG   Bos indicus (zebu cattle): 109570422
Entry
109570422         CDS       T04792                                 

Gene name
SERPINC1
Definition
(RefSeq) antithrombin-III isoform X1
  KO
K03911  antithrombin III
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109570422 (SERPINC1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109570422 (SERPINC1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109570422 (SERPINC1)
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109570422 (SERPINC1)
Peptidases and inhibitors [BR:biu01002]
 Peptidase inhibitors
  Family I4: serpin family
   109570422 (SERPINC1)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   109570422 (SERPINC1)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Haparin
  Coagulation and fibrinolysis
   109570422 (SERPINC1)
SSDB
Motif
Pfam: Serpin Tr-sialidase_C
Other DBs
NCBI-GeneID: 109570422
NCBI-ProteinID: XP_019831942
Position
16
AA seq 530 aa
MISNGIGTVTAGKRSICLLPLLLIGLWGCVTCHRSPVEDVCTAKPRDIPVNPMCIYRSSE
KKATEGQGSEQKIPGATNRRVWELSKANSHFATAFYQHLADSKNNNDNIFLSPLSISTAF
AMTKLGACDNTLKQLMEVFKFDTISEKTSDQIHFFFAKLNCRLYRKANKSSELVSANRLF
GDKSITFNETYQDISEVVYGAKLQPLDFKGNAEQSRLTINQWISNKTEGRITDVIPPQAI
NEFTVLVLVNTIYFKEVGQASXSAWQDSQMTPWXYYLCLALFIREKAQHFGGWSLRRRLV
GGRRQKAIRFKLQKRLAKRPGLWKSKFSPENTRKELFYKADGESCSVLMMYQESKFRYRR
VAESTQVLELPFKGDDITMVLILPKLEKTLAKVEQELTPDMLQEWLDELTETLLVVHMPR
FRIEDSFSVKEQLQDMGLEDLFSPEKSRLPGIVAEGRSDLYVSDAFHKAFLEVNEEGSEA
AXSTVISIAGRSLNSDRVTFKANRPFLVLIREVALNTIIFMGRVANPCVD
NT seq 1593 nt   +upstreamnt  +downstreamnt
atgatttccaatgggataggaaccgtcaccgctggaaaaaggagtatatgtcttctccct
ttgctgcttattggcctctggggctgtgtgacctgtcatcggagccctgtggaagacgtc
tgcacagccaaacctcgggacattcctgtgaatcccatgtgtatttaccgttcctcagag
aagaaggcaactgagggccaaggctccgagcagaagatccctggggccaccaaccggcgg
gtctgggaactgtccaaggccaattcccactttgccactgccttctatcagcatttggca
gactccaagaataacaatgacaacattttcctgtcacccctgagtatctccacagctttt
gctatgaccaagctgggtgcctgtgacaacacactcaagcagttgatggaggtttttaag
tttgataccatctctgagaaaacttctgatcagatccactttttctttgccaaactgaac
tgccgactctatcgaaaagccaataaatcctctgagttggtatcagccaaccgtcttttt
ggagacaaatccattacattcaatgagacctaccaggacatcagtgaggtggtatatggg
gccaagctccagcccctggacttcaagggaaatgcagagcagtccagattgactatcaac
caatggatatccaataagactgaagggcgtatcactgatgtcattcccccacaagccatc
aatgagttcactgtcctggtgctagtcaacaccatttacttcaaggaagttggccaggcc
tcaytctctgcctggcaggactcccagatgactccctgggrttactacctttgtctggct
ttattcatcagggagaaagcccagcattttggaggatggtctttgagaaggaggctggtg
ggaggcagaaggcaaaaggcaattagatttaaactccagaagagacttgccaagaggcca
ggcctgtggaagtcaaagttcagtcccgagaacacaaggaaggaactgttctacaaggct
gatggggagtcatgttcagtactcatgatgtaccaggaaagcaagttccgctatcggaga
gtagcagaaagcacccaggtgctcgagttgcccttcaagggtgatgacatcaccatggtg
ctcatcctgcccaagctggagaagaccctggccaaggtggaacaggaactcaccccagac
atgctgcaggagtggctggatgagctgacagagacgctgctggtggtccacatgccccgc
ttccgcatcgaggacagcttcagcgtgaaggagcagctgcaagacatgggcctcgaagac
ctgttcagtcctgagaagtccaggctcccaggtattgttgcagaaggtcggagcgacctc
tatgtctcagatgcattccacaaggcatttcttgaggtaaatgaggaaggcagtgaagct
gcakcaagtaccgtcattagcatcgctggtcgttcgctgaactcggacagggtgaccttc
aaggccaacaggcccttcctggttctcatcagggaagttgctctgaacactattatattc
atgggtagagtagccaacccttgtgttgattaa

DBGET integrated database retrieval system