KEGG   Bos indicus (zebu cattle): 109570433
Entry
109570433         CDS       T04792                                 

Gene name
CASP9
Definition
(RefSeq) caspase-9
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01524  Platinum drug resistance
biu04115  p53 signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04210  Apoptosis
biu04215  Apoptosis - multiple species
biu04370  VEGF signaling pathway
biu04919  Thyroid hormone signaling pathway
biu05010  Alzheimer disease
biu05012  Parkinson disease
biu05014  Amyotrophic lateral sclerosis
biu05016  Huntington disease
biu05020  Prion disease
biu05134  Legionellosis
biu05145  Toxoplasmosis
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05200  Pathways in cancer
biu05210  Colorectal cancer
biu05212  Pancreatic cancer
biu05213  Endometrial cancer
biu05215  Prostate cancer
biu05222  Small cell lung cancer
biu05223  Non-small cell lung cancer
biu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    109570433 (CASP9)
   04151 PI3K-Akt signaling pathway
    109570433 (CASP9)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109570433 (CASP9)
   04215 Apoptosis - multiple species
    109570433 (CASP9)
   04115 p53 signaling pathway
    109570433 (CASP9)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    109570433 (CASP9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109570433 (CASP9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109570433 (CASP9)
   05212 Pancreatic cancer
    109570433 (CASP9)
   05215 Prostate cancer
    109570433 (CASP9)
   05213 Endometrial cancer
    109570433 (CASP9)
   05222 Small cell lung cancer
    109570433 (CASP9)
   05223 Non-small cell lung cancer
    109570433 (CASP9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109570433 (CASP9)
   05012 Parkinson disease
    109570433 (CASP9)
   05014 Amyotrophic lateral sclerosis
    109570433 (CASP9)
   05016 Huntington disease
    109570433 (CASP9)
   05020 Prion disease
    109570433 (CASP9)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109570433 (CASP9)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    109570433 (CASP9)
   05152 Tuberculosis
    109570433 (CASP9)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109570433 (CASP9)
   05162 Measles
    109570433 (CASP9)
   05164 Influenza A
    109570433 (CASP9)
   05161 Hepatitis B
    109570433 (CASP9)
   05160 Hepatitis C
    109570433 (CASP9)
   05168 Herpes simplex virus 1 infection
    109570433 (CASP9)
   05163 Human cytomegalovirus infection
    109570433 (CASP9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109570433 (CASP9)
   05169 Epstein-Barr virus infection
    109570433 (CASP9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109570433 (CASP9)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    109570433 (CASP9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:biu01009]
    109570433 (CASP9)
   01002 Peptidases and inhibitors [BR:biu01002]
    109570433 (CASP9)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     109570433 (CASP9)
Protein phosphatases and associated proteins [BR:biu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     109570433 (CASP9)
Peptidases and inhibitors [BR:biu01002]
 Cysteine peptidases
  Family C14: caspase family
   109570433 (CASP9)
SSDB
Motif
Pfam: Peptidase_C14 CARD CARD_2
Other DBs
NCBI-GeneID: 109570433
NCBI-ProteinID: XP_019831965
Position
16
AA seq 452 aa
MNEADRLLLRRYRVRLVGELQVASLWDALLSRELFTPDMIEDIQRAGSGSRRDQARQLIL
DLETRGSQALPLFISCLEDTGQDTLASLLKTSRQAAKQDVEAIRPLDLKPVVLGPEGLKP
GEPRVMKQDPSKPSQGKLAPVVLGPEELWPAKLRPEVLRPEVPRAVDAGSGGFTDVCPQD
RAKGNADLAYVLNADPCGHCLIINNVNFCRESGLRARTGSNIDCERMRRRFHLLQFVVEV
KCDLTAKQMVQALMQLARQDHSALDCCVVVILSHGCQASHLQFPGAVYGTDGCPVSVERI
VNTFNGTGCPSLRGKPKLFFIQACGGEQKDHGFEVESTSPEDKTPSSDPEADATPFQEGP
RSIDEPDAVSSLPTPSDILVSYSTFPGFVSWRDPKSGSWYIETLDSIFEQWAHCEDLQTL
LLRVANAVSVKGIYKQMPGCFNFLRKKLFFKT
NT seq 1359 nt   +upstreamnt  +downstreamnt
atgaacgaggctgaccggctgctcctgcggcggtaccgggtgcggctggtcggtgagctg
caggttgcctcgctttgggacgctctgctgagtcgcgagctcttcactcccgacatgatc
gaggacattcagagggcaggctcaggatctcggcgcgatcaggccaggcagctaatccta
gatctagagactcgagggagtcaggcccttcctttgttcatctcctgcttggaggacaca
ggccaggacactctggcttcattattgaagaccagcagacaagcagcaaaacaggatgtg
gaggccatcagacccytggatctcaagccggtggtacttggaccagagggcctcaaaccc
ggggaaccgagagtgatgaagcaggacccatcaaagccgagccaaggaaaactcgctcca
gtggtgctggggccggaggagctctggccagccaagctcaggcctgaggttctcagacca
gaggtacccagggcagtggacgctggttctggaggattcactgatgtctgtcctcaggac
agagccaagggaaatgccgatctggcctatgtcctgaacgcagacccctgcggccactgc
ctgatcatcaacaacgtgaacttctgccgcgagtcggggctcagggcccgcacgggctcc
aacatcgactgtgagaggatgcggcgacgcttccacctgctgcagtttgtggtggaggtg
aaatgtgacctgactgccaagcaaatggtccaggctttgatgcagctggcgcggcaggac
cacagcgctctggactgctgcgtggtggtcatcctgtctcacggctgtcaggccagccac
ctccagttcccaggggctgtttatggcacagatggatgtcctgtgtccgtcgagagaatt
gtgaacactttcaatggtactggctgccccagcttgagagggaagcccaagctcttcttc
atccaggcctgtggtggagagcagaaagaccacgggtttgaggtggagtccacttcccct
gaagataagacccccagtagcgaccctgaggcggatgctaccccattccaggaaggccca
cgttccattgacgagccagatgccgtgtctagtttgcccacgcccagcgacatcttggtg
tcctactccaccttcccaggctttgtctcctggagggatcccaagagcggctcctggtac
atcgagaccctggacagcatttttgagcagtgggctcactgtgaggaccttcagaccctc
ctcctcagggtcgctaatgctgtttcagtgaaaggaatttacaaacagatgccgggctgt
tttaatttcctccggaaaaaacttttctttaaaacataa

DBGET integrated database retrieval system