KEGG   Bos indicus (zebu cattle): 109570441
Entry
109570441         CDS       T04792                                 

Definition
(RefSeq) complement factor H-related protein 1-like isoform X1
  KO
K23815  complement factor H-related protein 1/2/3
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109570441
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 109570441
NCBI-ProteinID: XP_019831979
Position
16
AA seq 324 aa
MLLLISVLTLWFYTAHGQGKHCNYPVIXHGRLYHSYRGHFPARVNQXFLYNCDQYFVPPS
XYSSDYLTCTAEGWSPEELCLRECIFNNLENXYTPSSERKAVQGETVRVRCYXGYSLQNN
QNTMTCTESGWSPPPRCIRVNVSCVNPPQVENAIIHNQKSXYQSGERARYESIGNYXLFG
EXEVICLNGIWTEPPQCKDSQGKCGPPPPIDNGDITSLLQSVYXXGSXVEYRCQAYYELX
GNRNVVCQNGEWSEPPKCLEACXISEETMRKHHIQLRWKYDKKXYSKTEDIIEFMCQYGY
RQLTAKHTFRTTCQEXKVVYPRCG
NT seq 975 nt   +upstreamnt  +downstreamnt
atgttgttgttaatcagtgtcctcaccttgtggttttacactgctcatggacaggggaaa
cattgtaattatccagtaataaracatggacggctatatcattcatacagaggacacttt
ccagcacgtgtaaatcaayagtttctctataactgtgatcagtattttgtgcctccttca
cwatattcctcrgattacctgacttgcacagcagaaggatggtctccagaagaactatgc
ctcagagaatgtattttcaataatttggaaaatgkatataccccaagtagtgaaagaaaa
gctgtacagggtgaaacagtaagggttcgctgctatyatggctacagtcttcaaaataat
cagaacacaatgacctgcacagagagtggctggtctcctcctcccagatgcatccgtgtc
aatgtttcctgtgtgaatccacctcaagtggaaaatgctattatacacaatcagaagtct
asatatcagagtggwgagagagcacgttaygaatccattgggaattatgasctttttgga
gagayagaagtcatatgtttgaatggaatttggacagaaccacctcagtgtaaagactct
caaggaaaatgtgggcctcctccaccaatagacaacggagacattacctcactcctgcaa
tcagtatatcytmcaggatcgrttgttgagtaccggtgtcaggcctactatgaacttcrg
ggaaacagaaaygtagtatgtcagaatggagagtggtcagaaccaccaaaatgcttagag
gcatgtstaatttcagaagaaacaatgagaaaacatcacatacagttaagatggaaatac
gataaaaaaytttactctaaaacagaggatattattgaatttatgtgtcaatatggttat
cgtcaactgacagcaaaacatacatttcgaacaacttgtcaggaagraaaggtggtgtat
cctcgatgtggataa

KEGG   Bos indicus (zebu cattle): 109570538
Entry
109570538         CDS       T04792                                 

Definition
(RefSeq) complement factor H-related protein 5-like isoform X1
  KO
K23817  complement factor H-related protein 5
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109570538
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 109570538
NCBI-ProteinID: XP_019832129
Position
16
AA seq 718 aa
MLITVNEAAPGGAASLQGQFQLHAAGVTGMLLLTHVLLILWISSVGGQGRHCDFPKINHG
ILYNEKKYKASFPVSLGKIFYYSCEYNYMPPSKHFWTPITCTEGGWSPTPKCLRVCFFPF
VENGQSASSGQIYLEGATVQITCNKGYSLPDNQGSITCAEGGWSSPPECISTKKCLKTDI
VVANGFLSESEYAYSVNKETQYKCKPGYTTADGKTSGTVQCLQGGWSSQPTCIKSCERPV
LVNARVKMDFTWFQLNDMLNYECDPGYKNQDGHTTGSIVCGEDGWSHLPICRETECQLPF
LEANVDAYPKQEKYKVGDVLKFSCRQRLKRVGPDSVQCYQFGWSPNFPTCKGQVRSCGQP
PQLPNGKMKHRKQEKYEHSEMVECDCNPNFVMKGPKKIQCMDGEWTALPTCVEPGKACGF
MPQLENGYSQPSVPPYRHGVSVVLSCRNAYTMIGNTTITCIDGIWTELPKCVATNQLKRC
EKPRFYTRSQLSSHMYEFNHNARVSYKCAGKSTYIQTVCIDGKWDPEPDCLGKKKPLCPP
PPQIPNAQNMLTTVNYQEGEKVAVLCKENHAFLEAKELVCRSGRWQSLPHCVESGQYCGP
PPPIGNGDITSFPLSAYPPGSNVQYRCQSFYELRGNLTVTCRNGRWSEPPACIDACIISE
DRMNKXNIQLKWRNPPKRYAKTGDFIEFECKHSHKERTPIQSFRVLCQEGKFEYPACE
NT seq 2157 nt   +upstreamnt  +downstreamnt
atgctcataactgtaaatgaagcagcaccrggaggagcagcttcactgcagggccagttt
cagttacacgctgctggcgtaactggcatgttgcttttaactcatgtccttctaatctta
tggatttcttctgtggggggacaagggagacattgtgattttccaaaaataaaccatgga
attctgtacaatgaaaagaaatacaaggcatctttcccagtttctcttgggaaaattttc
tattattcctgtgaatataattatatgcctccttcaaaacacttttggactcccataaca
tgcacagagggcggatggtcaccgactccaaagtgtctcagagtgtgtttctttcctttt
gtggaaaacggtcaatctgcatcttcgggacaaatatacctggaaggcgccactgtgcaa
attacctgcaataagggctacagtctcccggataaccagggcagcattacctgtgctgaa
gggggctggtcctcccctccggaatgcatctccaccaaaaaatgtttaaaaacagatatt
gtagttgccaatgggtttttgtctgagtcagaatatgcttattctgtgaataaagaaaca
caatataagtgtaaaccaggatatacaacagcagatggaaaaacgtcagggacagttcag
tgtttgcaaggtggatggtcaagtcaacccacttgtattaagtcctgtgagaggccagta
ttagtgaatgccagagtcaagatggatttcacgtggtttcagctcaatgacatgctgaac
tacgaatgcgaccccgggtataaaaaccaagatggacacaccacaggctccatagtgtgt
ggtgaagacggctggtcccatttgcccatatgccgtgaaacagaatgtcagcttccgttt
ttagaagcaaacgtagatgcttatccaaagcaagaaaaatacaaagttggagatgtgctg
aaattttcctgcagacaaagacttaaaagagttgggccggattcagttcaatgctaccaa
ttcggatggtcacctaattttccaacatgcaaagggcaagtgcgatcctgtggtcagcct
cctcaactgcccaatggaaaaatgaaacacagaaaacaagaaaaatacgaacacagtgaa
atggtggaatgtgattgcaaccctaattttgtaatgaaggggcctaagaaaatacagtgt
atggatggagaatggacagctctgcccacgtgtgttgaaccagggaaagcatgtggattt
atgcctcagcttgagaatggctatagccagccctctgtccctccctatcgacatggagtt
tcagtggtgttaagttgcagaaatgcatatacaatgattggaaatactacaattacatgt
attgatggaatatggaccgagcttcctaagtgtgttgcaacaaaccaacttaagaggtgt
gaaaaaccacggttttatacaagaagccagttaagttcacatatgtatgaatttaatcac
aatgccagagtaagttacaagtgtgctgggaagagtacatacatacagacagtctgcatc
gacgggaagtgggaccctgaaccagactgcctaggaaaaaagaagccactgtgcccgcct
cctcctcagattcctaacgctcagaacatgctaaccacagtgaattaccaggaaggagag
aaggtcgctgtcctctgtaaagaaaaccatgcatttctggaagcaaaagaacttgtgtgc
agaagtggacgatggcagtccttaccacactgcgtagagtctggacaatattgtgggccc
cctccgcctattggcaatggagacatcacctccttccccctgtcagcgtaccctccaggg
tcgaatgtccagtaccgctgccagtctttctatgaactccggggaaacctgactgtgacg
tgcagaaatggacgctggtcagaaccacccgcatgcatcgatgcatgtatcatatctgaa
gatagaatgaacaaaaawaacatacagttaaaatggagaaaccccccaaaaagatatgct
aaaacaggggattttattgaatttgagtgtaaacattcacataaagagagaacacccata
caatcatttcgagtcctctgtcaggaagggaaatttgaatatcccgcatgtgaatga

KEGG   Bos indicus (zebu cattle): 109570540
Entry
109570540         CDS       T04792                                 

Definition
(RefSeq) complement factor H-related protein 2-like
  KO
K23815  complement factor H-related protein 1/2/3
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109570540
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 109570540
NCBI-ProteinID: XP_019832132
Position
16
AA seq 278 aa
MNLPLRMSNMLLLLNVILTLWVCCAHGRGKTCDFPEIKHGSIYNENRYKKIFPADVGKYF
YYTCEHSFVTPSQSLWTRINCTEEGWSPTPKCLRQCFFPWVENGQSTSSGQTHREGDIVH
IVCDTGYSLPNGQSNITCGERGWSSPPECRHVYPRGRCGPPPPIDNGDTVSFPLSQYPPG
SAVEYQCQAYYVLQGNRHIVCRNGEWSEPPKCLDACVISEEMMKQHNIQLKWRDDKKLYT
RTDDTIEFTCKRGYRPTTPNXTFRTTCHEGKVVYPHCE
NT seq 837 nt   +upstreamnt  +downstreamnt
atgaacctgcctttgagaatgtctaacatgctgttactactcaatgtcatcctcaccctg
tgggtttgctgtgctcatgggcgaggaaaaacgtgtgattttccagaaataaaacatgga
agcatatataatgaaaatagatataaaaaaatcttcccagctgatgtagggaaatatttc
tactacacctgtgaacacagctttgtgactccttcacaatcactctggactcgaataaac
tgtacagaggaaggatggtccccaacaccaaagtgcctcagacagtgctttttcccttgg
gtggaaaatggtcaatctacatcttcaggacaaacgcaccgagaaggtgacatygttcac
attgtgtgtgatactggctacagcctcccaaatggtcagagcaacattacatgtggagaa
agaggctggtcctcccctcctgaatgccgtcatgtctaccctcgaggaagatgtgggcct
cctccaccaatagacaatggagacactgtctcattcccattatcacagtatcctccagga
tcggctgttgagtaccagtgccaggcctactacgtacttcagggaaacagacacatagtg
tgtcggaatggagagtggtctgaaccaccaaagtgcttagatgcatgtgtaatttcagaa
gaaatgatgaaacaacataacatacagttaaaatggagagatgataaaaaactttatact
agaacagatgacactattgaatttacatgtaaacgtggatatcgcccaacgacaccaaat
crtacatttcgaacaacctgtcatgaaggaaaagtggtgtatcctcattgtgaatga

KEGG   Bos indicus (zebu cattle): 109570541
Entry
109570541         CDS       T04792                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: complement factor H-related protein 3-like
  KO
K23815  complement factor H-related protein 1/2/3
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109570541
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 109570541
NCBI-ProteinID: XP_019832133
Position
16
AA seq 269 aa
MFLLINIVLTLWFSCAHGQVKPCDVPVIKHGRLYYAFKGYFPASVGQQFSYRCNRYFVTP
SQSSWDYMTCTLKGWSPEVPCLRQCTFNYLENGYYTNSQEKYLQGKTVRVRCHDGYSLHN
NQNTMTCTEKGWYPPPICVRVDSQGKCGPPPXIDNGDITSFLTPVYPLRSXCECQCQAYC
ELQGNRNXGENGEWAELPKCLEACEISEEMMKKHNLQLKWTSKKLYSKTQDHIEFICKRG
YHPVTPYPTFRAACREGQVVYPHCGQDTG
NT seq 810 nt   +upstreamnt  +downstreamnt
atgtttttgctaatcaatattgttctcaccttgtggttttcctgtgctcatgggcaagtg
aaaccttgtgatgttccagtaataaaacatggaaggttatattatgcatttaaaggatac
tttccagcragtgtaggtcaacagttttcctatcgctgcaaccggtattttgtgactcct
tcacaaagttcctgggattacatgacttgcaccctgaaaggatggtctccagaagtgccc
tgcctcagacaatgcactttcaattatttggaaaatggatattacacaaactcccaagaa
aartatttacaaggtaaaactgtaagagtccgctgccatgatggctatagtcttcacaat
aatcagaacacgatgacttgcacagagaagggctggtaccctcctccaatatgcgtccgc
gtcgactctcaaggaaaatgtgggcctcctccaamaatagataacggagacatcacctca
ttcctcacacctgtatatcctctgcggtcanattgtgagtgtcagtgccaggcctactgt
gagcttcagggaaacagaaacrtgggtgagaatggagagtgggctgagctgccaaagtgc
ttggaggcctgtgaaatttcagaagaaatgatgaagaaacataacctacagttaaaatgg
acttcaaaaaaactttactcaaaaacacaggatcatattgaatttatatgtaaacgtgga
tatcatccagtgacaccatatcccacatttcgagcagcttgtcgggaaggacaagtggtg
tatcctcactgtggacaagacactggttaa

DBGET integrated database retrieval system