KEGG   Bos indicus (zebu cattle): 109570480
Entry
109570480         CDS       T04792                                 

Definition
(RefSeq) tumor necrosis factor ligand superfamily member 6
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01524  Platinum drug resistance
biu04010  MAPK signaling pathway
biu04014  Ras signaling pathway
biu04060  Cytokine-cytokine receptor interaction
biu04068  FoxO signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04210  Apoptosis
biu04217  Necroptosis
biu04650  Natural killer cell mediated cytotoxicity
biu04722  Neurotrophin signaling pathway
biu04932  Non-alcoholic fatty liver disease
biu04940  Type I diabetes mellitus
biu05142  Chagas disease
biu05143  African trypanosomiasis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05168  Herpes simplex virus 1 infection
biu05170  Human immunodeficiency virus 1 infection
biu05200  Pathways in cancer
biu05205  Proteoglycans in cancer
biu05320  Autoimmune thyroid disease
biu05330  Allograft rejection
biu05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109570480
   04014 Ras signaling pathway
    109570480
   04068 FoxO signaling pathway
    109570480
   04151 PI3K-Akt signaling pathway
    109570480
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109570480
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109570480
   04217 Necroptosis
    109570480
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109570480
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    109570480
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109570480
   05205 Proteoglycans in cancer
    109570480
  09163 Immune disease
   05320 Autoimmune thyroid disease
    109570480
   05330 Allograft rejection
    109570480
   05332 Graft-versus-host disease
    109570480
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109570480
   04932 Non-alcoholic fatty liver disease
    109570480
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109570480
   05162 Measles
    109570480
   05164 Influenza A
    109570480
   05161 Hepatitis B
    109570480
   05160 Hepatitis C
    109570480
   05168 Herpes simplex virus 1 infection
    109570480
   05163 Human cytomegalovirus infection
    109570480
   05165 Human papillomavirus infection
    109570480
  09174 Infectious disease: parasitic
   05142 Chagas disease
    109570480
   05143 African trypanosomiasis
    109570480
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    109570480
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109570480
   04052 Cytokines and growth factors [BR:biu04052]
    109570480
   04090 CD molecules [BR:biu04090]
    109570480
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   109570480
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Tumor necrosis fators
   109570480
CD molecules [BR:biu04090]
 Proteins
  109570480
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 109570480
NCBI-ProteinID: XP_019832031
Position
16
AA seq 277 aa
MQQPLNYPYPPIFWVDSSASSPWASPGSVFPCPSSVPGRPGQRRPPPPPPPTLPPPPPLP
PLPPPPLKKRRDHNTGLCLLVMFFMVLVALVGLGLGIFQLFHLQKELAELRESTSQRHTA
SSLEKQIGHPSPPSEKKELKKAAHLTGKLNSRSIPLEWEDTYGIALVSGVKYKKGSLVIN
ETGLYFVYSKVYFRGQSCNNQPLSHKVYSRNFRYPQDMVLMEGKMMNYCTSGKMWARSSY
LGAVFNLTSADHLYVNVSELSLVSFEESKTFFGLYKL
NT seq 834 nt   +upstreamnt  +downstreamnt
atgcagcagcccttgaattacccataccccccaatcttctgggtggacagcagtgccagc
tccccctgggcctctccaggatcagtcttcccctgtccgtcctcagtgccaggaaggccg
gggcaaaggaggccaccaccaccgccacccccaacactaccgccaccgccacccctgcct
ccactaccgccaccacctctgaagaagaggagggaccacaacacaggcctgtgtctcctt
gtgatgtttttcatggttctggtggccctggttggattggggctggggatatttcagctc
ttccatctacagaaggagttggctgaactcagagagtccaccagccaaaggcatacagca
tcatctttggagaagcaaataggtcaccccagtccaccctctgagaaaaaggaactgaaa
aaagcagctcatttaacaggcaagctcaactcaagatccatccctttggaatgggaagac
acctatggaattgccctggtctctggggtgaagtacaagaagggcagccttgtgatcaat
gaaactgggctgtattttgtgtattccaaagtgtacttccggggtcagtcctgcaacaac
cagcccctgagccacaaggtctactccaggaactttaggtacccccaggacatggtgctg
atggaggggaagatgatgaactactgcacttctggcaagatgtgggcccgcagcagctac
ctgggggctgtattcaatctaaccagtgctgaccatttatatgtcaatgtatctgaactc
tctctggtcagttttgaggaatctaagacattttttggcttatataaactctaa

DBGET integrated database retrieval system