KEGG   Bos indicus (zebu cattle): 109570498
Entry
109570498         CDS       T04792                                 

Gene name
PTPRC
Definition
(RefSeq) receptor-type tyrosine-protein phosphatase C
  KO
K06478  receptor-type tyrosine-protein phosphatase C [EC:3.1.3.48]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu04660  T cell receptor signaling pathway
biu04666  Fc gamma R-mediated phagocytosis
biu05132  Salmonella infection
biu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109570498 (PTPRC)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    109570498 (PTPRC)
   04666 Fc gamma R-mediated phagocytosis
    109570498 (PTPRC)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    109570498 (PTPRC)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109570498 (PTPRC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:biu01009]
    109570498 (PTPRC)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109570498 (PTPRC)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     109570498 (PTPRC)
Protein phosphatases and associated proteins [BR:biu01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Receptor PTPs
    109570498 (PTPRC)
CD molecules [BR:biu04090]
 Proteins
  109570498 (PTPRC)
SSDB
Motif
Pfam: Y_phosphatase fn3 PTP_N CD45 Y_phosphatase3 DSPc PTPlike_phytase SieB SCIMP
Other DBs
NCBI-GeneID: 109570498
NCBI-ProteinID: XP_019832054
Position
16
AA seq 1145 aa
MTMYLWLKLLAFGFAFLDIAVFVAGNSTQPFTQDEQTTTPALTTASSVSPATALSTIAPT
KPPCENKYGGVSVKYSFKDNKTFTATLDVEXXECEPPGCEKEHXGLPACQTXXXNMSHPS
CEPPFEYVLEVPPDPNQFQLVENVEDXEANTSLCLXWENKDFLGNGQFXCNEXKIEYKFK
CDGXXXXXNKNTFEVRNLKPRTNYTCSSQVLYNQQLLISQNKTIETDFGEPEAPQNFTCS
AKNATEGKCTWTPPQSYFDRISLCYWITPGGRNCIPQDKTQDGIDLHNLRPFTNYMVVLQ
ARVTGKVTRSRNATYTFWTDPAKPSKVNGLSASRKTENTIAVSCKRPDQLNGPEGKYYLE
VRTGNTLVKKDSGPECRFLVEDLQYLTEYNFLVYYNNTKFAGLRESVTASTSYNAKALII
FLVFLIIVTSIALLIVLYKIYDLHKKRSSNLDEQQELVERDDEKQLMNVEPIHADVLLET
YKRKMADEGRLFLAEFQSIPRVFSKFSIKDARKSFNQNKNRYVDILPYDYNRVELSDING
DAGSNYINASYIDGFKEPRKYIAAQGPRDETVDDFWRMIWEQKATVIVMVTRCEEGNKNK
CAEYWPSMDEGSRVYGDVIVEINEHKRCPDYIIQKLTVGNRKEKASGRAVTHIQFTSWPD
HGVPEDPHLLLKLRRRVNAFSNFFSGPIVVHCSAGVGRTGTYIGIDAMLEGLEAENKVDV
YGYVVKLRRQRCLMVQVEAQYILIHQALVEYNQFGETEVSLSELHPYLSNMKKRDPPSEP
SPLEAEFQRLPSYRSWRTQHIGNQEENKSKNRNSKIIPYDFNRVALKHELETSKESEQDS
DESSDDDSDLEEISRYINASFVMSYWKPEVMIAAQGPLKETIGDFWQMVFQRKVRVIVML
TELKSGDKEACAQYWEEGKQAYGDVEVHMKDTNKSSAYTVRAFELRHSKRKDPRTVYQYQ
FNNWNGEELPAEPKELVLMIQNLKQKLPKKNSAEGNKYHRNVPLLIHCRDGSQQTGIFCA
LFNLLESADTEEVIDVFQAVKSLRKARPGMVPTFEQYQFLYDVIASTYPAQNGQVKKSKH
PEDKVEIDNEVDKAKPDANCTSPPEALEKTSEGDKEAGGAKPTEGAEGPEHAANGPASPV
LTQSA
NT seq 3438 nt   +upstreamnt  +downstreamnt
atgaccatgtatctgtggcttaaacttctggcattcggctttgccttcctggacatcgca
gtgtttgttgcaggaaactctacccaaccttttactcaagatgagcagaccacgaccccc
gcactgaccactgcatccagcgttagccctgcaaccgctctctcaaccatagctcctact
aagccaccgtgtgagaacaaatacggaggtgtgtctgtgaagtactctttcaaggataac
aagacatttactgcaacactcgatgttgaggraraggaatgtgaacctcctggatgtgaa
aaggagcaccstggcctgcctgcatgtcaaactnnnnnnnnnaatatgtcacacccttcg
tgtgagcctccatttgaatatgtcttggaggtaccaccagatcctaatcagtttcagctg
gtagaaaacgtggaagatraagaagcaaatacttccctttgtttacwytgggaaaacaaa
gattttctaggtaatggacaattcragtgtaatgaaartaaaattgaatacaaatttaaa
tgtgatggnnnnnnnnnnnnnnnnaataaaaacacatttgaagtgaggaatcttaaaccc
agaactaattatacttgtagttcacaagtactctataatcaacagcttcttattagccaa
aataaaactattgaaacagattttggagaaccagaagcacctcagaattttacttgttct
gctaaaaatgcaactgaaggaaagtgtacctggacaccacctcaaagctattttgacaga
atctctctttgctattggattactccaggtggacgaaattgcatccctcaggataaaacc
caggacggaatagatttgcacaatttgagacctttcacaaactatatggtggtgttacaa
gcccgggtcacaggaaaagtaactcgcagtagaaatgcgacctatacattttggacagat
ccagcaaagccaagcaaggtcaatggtttaagtgcttcacggaagacagaaaatactata
gctgtgagctgtaaacgtcctgaccagcttaatggccccgaagggaagtactatttggaa
gtaagaactggaaataccttggttaaaaaagattcaggaccagaatgcagattcttggta
gaagatcttcagtatttaacagaatataattttttggtctattataacaatacaaaattt
gctggtcttcgggagagtgttacagcatcaacatcttataatgctaaagcactcatcata
tttttggtatttctgattattgtgacatcaatagccctgctcattgttctctataaaatc
tatgatctgcataagaaaagatccagcaatttagatgagcagcaggaactcgttgaaagg
gatgatgagaagcagctgatgaacgtggagcccattcatgcagatgttttgctggagact
tacaagcggaagatggctgacgaggggaggctcttcctggctgaatttcagagcattcca
cgggtattcagcaagttttccatcaaggatgctcgaaaatcctttaaccagaacaaaaat
cgctatgttgatatccttccttatgactacaaccgtgttgaactctctgacataaacgga
gatgcaggatcaaactatataaatgccagctatattgatggtttcaaagagcccaggaag
tacatcgcagcacaaggtcccagggatgagactgttgatgatttctggaggatgatctgg
gagcagaaagccacggttattgtcatggtcactcgatgtgaggaagggaacaagaacaag
tgtgcagagtactggccgtcaatggacgagggcagccgggtttatggagatgtgattgtg
gagatcaacgagcacaaaagatgcccagattacatcattcagaagctgactgttggaaac
agaaaagaaaaggcaagtggaagagcagtaactcacattcagttcaccagctggccggac
cacggggtccccgaagaccctcacctgctgctcaagctgcgcaggagggtaaacgctttc
agcaacttcttcagcggccccatcgtggtgcattgcagtgctggcgttgggcgcacaggc
acctacatcggcatcgacgccatgctggaaggcctggaggcagagaacaaggtggacgtc
tacggctacgtcgtcaagctccggcgacagaggtgcctgatggtgcaggtggaggcacag
tacatcttgattcaccaggccttggtggagtacaatcagtttggrgagacagaagtgagc
ctgtctgagctacacccgtacctgtctaacatgaagaaaagagacccgcccagtgagccc
tccccactggaggctgagttccagagacttccttcttataggagctggaggacacagcat
attgggaaccaagaagaaaataagagtaaaaacaggaattctaaaatcattccatatgac
tttaacagagtggcactgaaacatgagctggaaacgagcaaggagagtgagcaagactca
gatgagtcctctgatgatgacagcgacttggaggagataagcagatacatcaatgcctcc
tttgtcatgagttactggaaacctgaagtgatgattgcggctcagggaccgctgaaggag
accattggtgacttctggcagatggtcttccaaagaaaagtcagggtgatcgttatgctg
acggaactgaagagtggagacaaggaagcctgtgctcagtactgggaggaaggaaagcaa
gcctacggagatgtggaagttcacatgaaggacaccaacaaatcttcagcgtataccgtc
cgtgcatttgaactgagacactccaagaggaaagatccccgaacggtgtaccagtaccaa
tttaataactggaatggggaagagctgcccgcagaacccaaagaactggtcttgatgatc
cagaatctcaaacaaaaacttcccaagaagaattctgccgaagggaataaatatcacagg
aatgtgcctcttctcatccactgcagagatggatctcagcaaacaggaatattttgcgcg
ttgttcaacctcttagaaagcgctgacacagaagaagtgatagatgtgtttcaagctgtg
aagtcgctccgcaaagctcggccaggaatggtccccaccttcgagcaataccaatttctg
tatgacgtcattgctagcacctatcctgcccagaatggacaagtaaagaaaagcaagcat
ccagaagataaggttgagattgataacgaggtggacaaagctaagccggatgctaactgc
acaagccccccggaggccctggagaagacttccgaaggagacaaagaggccggaggcgcc
aaacccacagaaggtgctgaggggccggagcacgccgccaacggtcccgcgagtcccgtt
ttaactcagagtgcatag

DBGET integrated database retrieval system