KEGG   Bos indicus (zebu cattle): 109570510
Entry
109570510         CDS       T04792                                 

Gene name
F5
Definition
(RefSeq) LOW QUALITY PROTEIN: coagulation factor V
  KO
K03902  coagulation factor V (labile factor)
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109570510 (F5)
SSDB
Motif
Pfam: F5_F8_type_C Cu-oxidase_3 LSPR Cu-oxidase_2 Cu-oxidase
Other DBs
NCBI-GeneID: 109570510
NCBI-ProteinID: XP_019832075
Position
16
AA seq 2124 aa
MFLACPGFWVLVVLGSSWAGWGNLGAEAAKLRQFYVAAQSIRWNYRPESTHLSSKPFETS
FKKIVYREYEAYFQKEKPQSRTSGLLGPTLYAEVGDIMKVHFKNKAHKPLSIHAQGIKYS
KFSEGASYSDHTLPMEKMDDAVAPGQEYTYEWIISEDSGPTHDDPPCLTHIYYSYVNLVE
DFNSGLIGPLLICKKGTLTEDGTQKMFEKQHVLMFAVFDESKSWNQTSSLMYTVNGYVNG
TMPDITVCAHDHISWHLIGMSSGPELFTIHFNGQVLEQNHHKISAITLISATSTTANMTV
SPEGRWTIASLIPRHFQAGMQAYIDIKNCAKKTRNPKKLTRDQRRHIKRWEYFIAAEEVI
WDYAPIIPANMDKKYRSLHLDNFSNRIGKHYKKVVYKQYQDDSFTKRLEDPSSEGDGILG
PIIRAQVRDTLKIVFKNMASRSYSIYPHGVTFSPYDNEVNSSSASGSNTMIRAVRPGETY
TYKWNILESDEPTENDAQCLTRPYYSNVDITRDLASGLIGLLLICKSRSLDRRGIQRAAD
IEQQAVFAVFDENKSWYIEDNIYKFCENPEKVKRDDPKFYESNIMSTINGYVPESIPILG
FCFDDTVQWHFCSVGTQNDIFTIHFTGHSFIYGKRHEDTLTLFPMQGESVTVTMDNVGTW
MLTTMNSNPRSKKLRLRFRDAKCIRNDDDDSYEIIYEPSGSTAMTTKKIHDSSEIEDEND
ADSDYQDELALILGLRSFRNSSLNQEKDELNLTALALEKDSEFIPPSANRSLGSNSSSPS
HVSRLIANNFAESLKTLLHLEAPAAGSPLEHAGLDKNSALNPPMAEHSSPYSEDPREDHP
LSDVTGISLLPFGTGFKNRKPAKHQRFQVGRGQAAKHKFSQTRFPAHKTRTRLSKDNSSS
SRMGPWEDIPSDLLLLQQKDPYKILNGEWHLVSEKGSYEIIQDANENKTVNKLPNSPQND
SRTWGENIPFKNSHGKQSGHPTFLVTRRKPLQDRQDRRNRLKEGLSIIRTRRKKXEEKPA
YHVPLSPRXFHPLRGEVNASFSDRRHNHSLLLHASNETSLSIDLNQTFPSMNLSLAASLP
DHDQTSPNDTTSQTSSPPDLYPTVSPEEHYQIFPIQDSDPTHSTTAPSNRSPDPTHSTTA
PSNRSPPTQPSQIPNYDLRNRAIPTDVSQIFPSLELEVWQTATSLDLSQPSISPDLGQMA
LSPDPGQESLSPDLGQTSLSPDLSQESLSPDLGQTALSPDPSQESLSPDLGQTSLSPDLG
QESLSPDLGQTALSPDPSQESLSPDLGQTSLSPDLGQTALSPDPSQESLSPDLGQTSLSP
DLGQESLSPDLGQTALSPDLSLESLSPDLSQLDLKQTSPPLDLNQTSHTSESSQSLPLPE
FGQTFPNADIGQMPSPPPDSTLNNTFKPEEFNPLVVVGLSRDDGDYIEIIPRQKEESSEE
DYGEFEFVAYNDPYQTDLRTDINSSRNPDNIAAWYLRSNTGNRKYYYIAAEEISWDYSKF
VQSDDIDYVPEDTVYKKVVFRKYLDSTFTKLDPQGEYEEHLGILGPVIRAEVDDVIQVRF
KNLASRPYSLHAHGLSYEKSSEGKTYEDDSPEWFKEDNAIQPNKTYTYVWHATTRSGPEN
PGSACRAWAYYSAVNPEKDIHSGLIGPLLICRKGTLDKETNMPVDMREFVLLFMVFDEKK
SWYYDKKPTRSWRRASSEVKNSHEFHAINGMIYNLPGLRMYEQEWVRLHLLNLGGSRDIH
VVHFHGQTLLENGTQQHQLGVWPLLPGSFKTLEMKASKPGWWLLDTEVGEIQRAGMQTPF
LIVDRECKMPMGLSTGLIADSQIQASEFWGYWEPKLARLNNGGSYNAWIAEKLSTEFNPE
PWIQVDMQKEVLLTGIQTQGAKHYLKPYYTTEFCVAYSLDRKNWRXFKGNSTRNVMYFGG
NSDASTIKENQIDPPVVARYIRISPTGSYNKPALRLELQGCEVNGCSTPLGMESGKIENK
QITASSFKKSWWGNYWEPFLARLNAQGHVNAWQAKANNNNQWLQIDLLKIKKITAIVTQG
CKSLSSEMYVKSYTIHYSDQGTDWKPYREKSSMVDKIFEGNNNVRGHVKNFFNPPIISRF
IRIIPKTWNQSIALRLELFGCDMY
NT seq 6375 nt   +upstreamnt  +downstreamnt
atgttcctcgcttgccctggcttctgggtcctcgtggtcctaggcagcagctgggcaggc
tgggggaacctaggggctgaagcagcaaagctaaggcagttctacgtagctgctcagagc
atcagatggaactaccgccccgagtccacacacctcagttcgaaaccttttgaaacctcc
tttaagaaaattgtctacagggagtatgaagcatattttcagaaagaaaaaccacaatcc
agaacttcaggacttcttgggcctactttgtatgctgaagttggagacatcatgaaagtt
cactttaagaataaagcacacaagcccttaagcatccatgctcaaggaattaagtacagt
aaattctcagaaggtgcgtcttactctgaccacacactccccatggagaagatggatgat
gctgtagctccgggccaagaatatacctatgagtggattatcagtgaggacagtgggccc
acccacgatgaccctccatgcctcacacacatctattactcctatgtaaatctggtggag
gacttcaactctggactgattggacctctgcttatttgtaagaaaggcaccctaactgag
gatggaactcagaaaatgtttgagaagcaacatgtactgatgtttgctgtgtttgatgaa
agtaaaagctggaaccagacatcatccttaatgtacacagtcaatggctatgtgaatggg
acgatgccagatataacagtctgtgcccatgaccacatcagttggcatctgattggaatg
agctctgggccagaactgttcaccatccatttcaatggtcaggtcctggagcagaaccat
cataagatctcagccatcactctcatcagcgccacgtccacaaccgcaaacatgaccgtg
agccccgagggaaggtggaccatagcttctctcatccccagacattttcaagctgggatg
caggcttacatagacattaaaaactgtgcaaagaaaaccagaaatcctaagaaactaact
cgagaccagaggcggcacattaagagatgggaatacttcattgctgcagaggaagtcatt
tgggactatgcacctataataccagcaaacatggacaaaaaatacagatctctgcatttg
gataatttctcaaaccgaattggaaaacattataagaaggttgtctacaaacagtaccaa
gatgactccttcaccaaacgcctggaggatcccagtagtgaaggagatgggatcttgggc
cctattatcagagcccaggtcagagacacactgaaaatcgtgttcaaaaatatggccagc
cgctcctacagcatttaccctcacggtgtgacattctctccttatgacaatgaagtaaac
tcttcctcagcctcaggcagcaacaccatgatcagagcagttcgaccaggggaaacctac
acttataagtggaacatcctagaatctgatgaacccacagaaaatgatgctcagtgctta
acaagaccatactacagtaatgtggacatcacaagggaccttgcttctggactgataggg
cttcttctaatttgtaagagcagatccttggatagacgaggcatacagagggcagcagac
attgagcagcaggctgtgtttgccgtgtttgacgagaacaagagctggtacattgaggac
aacatctacaagttttgtgaaaatcctgagaaagtgaaacgtgatgaccccaagttttat
gagtcaaacatcatgagtactattaacggctatgtgcctgagagtatacccatactaggg
ttctgctttgatgacactgtccagtggcacttctgcagtgtgggaacccagaatgacatt
tttaccattcacttcactgggcactcattcatctatggaaagaggcatgaggacaccttg
acccttttccccatgcagggggaatccgtgactgtcacaatggataacgttggaacttgg
atgttaaccaccatgaattccaatccaagaagcaaaaaactacggctgaggttcagggat
gctaagtgtatccggaatgatgatgatgactcctatgagattatatatgaaccttcagga
tctacagccatgactacaaagaaaattcatgattcttcagaaatcgaagatgaaaatgat
gctgactctgattaccaggatgaactggctttaatactaggtcttaggtcattcagaaat
tcatcactgaatcaagagaaagatgagctcaatcttaccgccctagctctggagaaagac
tctgaattcattcctccaagtgccaacagatctcttggttcaaattcttcttccccaagt
catgttagcaggcttattgccaacaactttgcagaatctctgaaaactcttctgcacctg
gaagcccctgcagctggttcccccctggaacacgctggcttagataagaactcagctctc
aaccctcccatggcagagcattccagcccttattctgaagaccctagagaagatcatcca
ctctcagatgtcacagggataagcctacttccatttggcacaggattcaaaaatcgaaaa
cctgccaaacatcaaagattccaggtaggaagaggccaagcagcaaagcataagttctcc
cagacgcgattcccagcacataaaaccaggacacgtttaagcaaagacaactcttcttct
tccagaatggggccctgggaggacattcccagtgatctgttactcttacaacaaaaggat
ccatataagattctgaatggagaatggcatttggtttctgagaaaggcagttatgaaata
atccaagatgctaatgaaaacaagactgttaataagttgccaaacagcccccagaatgac
tcaaggacttggggagaaaacatccctttcaaaaacagtcatggaaagcagagtggccac
ccaacatttttggtaactagacgtaaacctctacaagacagacaggatagaagaaataga
ttgaaggaaggcctttccatwattaggacacgaagaaagaaanargaagagaagcctgca
taccatgttcctctatctccaaggnagtttcatcctctgagaggagaggtcaatgcctca
ttttcagacagaagacataatcattcattgttactccatgcgtccaatgaaacatctctt
tccatagacctcaatcagacattcccctctatgaatcttagccttgcagcctcacttcct
gaccatgaccagacctcaccaaatgacaccaccagtcagactagctcccctccagatctt
tatccgacagtgagcccagaggaacactatcaaatattccctattcaagactctgatcca
acacattctactacagcccccagtaacagatctcctgatccaacacattctactacagcc
cccagtaacagatctcctcccacacagcccagccagatacccaactatgacctaagaaac
agggccatccctactgatgtgagtcaaattttcccttccttggaactcgaagtctggcag
acagctacctctctagacctcagtcaaccatccatctccccagaccttggccagatggcc
ctttccccagaccccggccaggagtctctctctccagaccttggccagacgtccctctct
ccagacctcagccaggagtctctctccccagaccttggccagacagccctttccccagac
cccagccaggagtctctctctccagaccttggccagacgtccctctctccagaccttggc
caggagtctctctccccagaccttggccagacagccctttccccagaccccagccaggag
tctctctctccagaccttggccagacgtccctctctccagaccttggccagacagccctt
tctccagaccccagccaggagtctctctctccagaccttggccagacgtccctctctcca
gaccttggccaggagtctctatccccagaccttggccagacagccctttccccagacctc
agcctggagtctctctctccagacctcagccagcttgatctcaagcagacatcacctcct
ctagatcttaatcagacatcccacacttctgaatcaagtcagtcattgcctcttccagaa
tttggtcagactttccctaatgcagatattggtcagatgccatctcctccaccagactct
acactaaataacacttttaaaccagaagaatttaatccgctggttgtagtaggcctcagt
agagatgatggagattatattgaaattattccaaggcagaaggaagagagcagtgaagaa
gactatggtgaatttgagtttgtagcctataatgacccttaccaaactgatcttaggaca
gatatcaactcctccagaaatcctgacaacattgcagcatggtacctccgcagcaacact
ggaaacagaaaatattattacattgcagctgaagaaatatcctgggattattcaaaattt
gtgcaaagtgatgacattgactatgttccagaggacaccgtatacaagaaagtagttttc
cgaaagtaccttgatagcacttttaccaaacttgatcctcagggggagtatgaagagcat
cttggcatacttggtccagtcattagrgctgaagtggatgatgttatccaagttcgtttt
aaaaatttagcatccagaccatattctcttcatgcccatgggctttcctatgaaaaatca
tcagaaggaaagacttatgaagatgactctcctgaatggtttaaggaggacaatgctatt
cagcccaataaaacttacacctatgtatggcacgccactacgcgatccgggccagaaaac
cctggatctgcctgtcgggcttgggcctactactcagcagtgaacccagaaaaagacatc
cattcaggcttgatagggcctcttctgatctgccgaaaagggacacttgataaggagacc
aacatgcctgtggacatgagagaatttgtcctgctttttatggtctttgatgaaaagaag
agctggtattatgacaagaagcccacaaggtcttggagacgtgcatcctcagaagtaaaa
aactcccatgagtttcatgccatcaatgggatgatctacaacttgcctggcttgagaatg
tacgagcaagagtgggtgaggttgcacctgctgaacttaggcggctcccgagacattcac
gtggttcactttcatggccagaccttgctagaaaacggcactcaacagcaccagttaggg
gtctggccccttctgcctggttcatttaaaactcttgaaatgaaggcatcaaaacctggc
tggtggctcctagacacggaagttggagaaattcagagagcagggatgcagacaccattt
ctcattgtagacagagaatgtaagatgccaatgggactaagcactggcctgatagctgac
tcacagatccaggcttctgagttttggggttattgggaacccaaattagcaaggttaaac
aatggtggatcatacaatgcttggattgcagaaaaactttcaacrgaatttaaccctgaa
ccttggatccaggtagacatgcaaaaggaagtcctgctcacggggatccagacccagggc
gccaaacactacctgaagccctactacaccaccgagttctgtgtggcttacagcttggat
cggaaaaactggcggaycttcaaagggaacagcacaaggaatgtgatgtattttggtggc
aattcagatgcttctacaataaaagagaatcagattgacccacctgttgtggctagatac
attaggatctctccaactggatcctataacaaacctgcccttcgattggagctgcaaggt
tgtgaggttaatggatgctccacaccgctgggtatggaaagtggaaagatagaaaacaag
caaatcaccgcttcctcgtttaaaaagtcttggtggggaaattactgggaacccttcctt
gcacgtcttaatgcccagggccatgtaaatgcctggcaagctaaggcaaacaacaacaat
cagtggttacaaattgatctgctcaaaatcaagaagataactgcgattgtaacacaagga
tgcaagtctctgtcctctgaaatgtatgtgaagagctacaccatccactacagtgaccag
ggaacggactggaaaccttacagggagaaatcctcaatggtggacaagattttcgaagga
aataataatgtcagaggacatgtgaagaactttttcaacccaccaatcatctccaggttt
atacgcatcattcctaaaacatggaatcagagtattgcacttcgcttggaactctttggc
tgtgatatgtactag

DBGET integrated database retrieval system