KEGG   Bos indicus (zebu cattle): 109570520
Entry
109570520         CDS       T04792                                 

Definition
(RefSeq) complement factor H isoform X1
  KO
K04004  complement factor H
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
biu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109570520
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    109570520
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109570520
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109570520
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 109570520
NCBI-ProteinID: XP_019832094
Position
16
AA seq 738 aa
MLXLINVLLTLWFYTAHGQEIFCKTPVILNGQAVLPKATYKANEXVQYRCAAGFEYGQRG
DTICTKSGWTPAPTCIEITCDPPXIPNGVYRPELSKYRGQDKITYECKKGFFPEIRGTDA
TCTRDGWVPVPRCAWKPCSYPVIKHGRLYYSYRGYFPARVNQQFVYSCDHHFVPPSQRSW
DHLTCTAEGWSPEEPCLRQCIFNYLENGHNQHXEEKYLQGETVRVXCYEGYSLQNDQNTM
TCTESGWSPXPRCIRVKTCSKSNIRIENGFLSESTFTYPLNKQTEYKCKPGYVTADGKTS
GLITCLQNGWSTQPVCIKSCARPVFENARAKSDGTWFRLNDRLDYECLHGYENQDGHTTG
SIVCGQDGWSDKAACYERECSIPEMDPYLNAYPRKETYKVGDVLKFSCSQGRIMVGADSV
QCYHFGWSPKLPTCKVKKVKSCALPPELPNGKRKEIHKEEYAHNEVVEYACNPXFLMKGS
HKIQCVDGEWTALPVCIEEERTCGBIPDLDHGDVKPSVPPYHHGDXVEFSCREAFTXIGP
RFITCISGEWTQPPQCIATDELRKCKGSTLFPPEGRPAHKIEYDHNTNKSYQCRGKSEXK
HSICINGEWDPKVDCNEEAKIQLCPPPPQVPNAXDMTTTVNYQDGEKISILCKENYLIQD
AEEIVCKDGRWQSIPRCIVVKKLLATQEMQKIRVRSLDGEDPLGRRVXTHSSXVAWEIPW
TEEPVGLESTGSXRVGHD
NT seq 2217 nt   +upstreamnt  +downstreamnt
atgttgwtgttaatcaatgtccttctcaccttgtggttttacactgctcatggacaggaa
attttctgcaaaacaccagtcattttaaatggacaagctgtacttccaaaggcaacttat
aaggcaaatgaaygagttcaatacagatgtgcagccggttttgaatatggtcagagagga
gatacaatatgcactaaatctggatggactccagctcctacttgtatagaaataacatgt
gatcctcctcrtattccaaacggtgtgtacagacctgaattaagcaaatacagaggtcaa
gataaaatcacttatgagtgtaaaaagggtttttttcctgagatmcgtggaactgatgca
acgtgtaccagagatggctgggtacctgttccgagatgtgcctggaaaccttgtagttat
ccagtaataaaacatggacggctatattattcatacagaggatactttccagcacgtgta
aatcaacagtttgtctatagctgtgatcatcattttgtrcctccttcacaacgttcctgg
gaccacctgacttgcacagcagaaggatggtctccagaagaaccatgcctcagacaatgt
attttcaattatttggaaaatggacataaccaacatcstgaagaaaaatatttacagggt
gaaactgtaagagttcrctgctatgaaggctacagtcttcaaaatgatcagaacacaatg
acctgcacagagagtggctggtctcctcmtcccagatgcatccgtgtcaaaacatgttca
aaatccaatataaggattgagaatggatttttgtctgaatctacctttacgtatccccta
aataaacaaacagaatataagtgtaaaccaggatatgtaacagcagatggtaagacttca
ggattaattacatgtctgcaaaatggatggtcaactcaacctgtatgcattaaatcctgt
gccaggccagtatttgagaatgccagagccaaaagtgatggcacatggttcagrctgaac
gacaggctggactacgaatgtctccatgggtatgagaaccaagatggacacaccacaggc
tccatagtatgtggtcaagacggctggtctgataaagctgcatgctatgaaagagaatgc
agtattccygaaatggatccatacttaaatgcttatcccaggaaagaaacatataaagtt
ggagatgtgctgaaattctcctgcagtcaaggccgtattatggttggagcagattcagtt
cagtgctaccactttggatggtcccctaaacttccaacgtgtaaagtaaagaaagtaaag
tcctgtgctctacctcctgaacttcctaatgggaaaaggaaagaaatacacaaagaagaa
tatgcacacaatgaggtcgtggaatatgcttgcaaccccaratttctgatgaagggttct
cataaaattcagtgtgttgatggagaatggacagctttacctgtgtgtattgaggaggag
cgtacctgtggaratatacckgaccttgatcacggcgatgtcaagccttctgtccctccc
tatcaccatggagactyggttgagttcagttgcagagaagcatttacaatsattggaccc
agatttatcacgtgtattagtggagagtggacccagcctcctcagtgcattgcaacagat
gaacttaggaagtgtaaagggtcaacattatttccacctgaggggagaccagcacataag
attgaatatgaccataacaccaacaaaagttaccaatgtcgaggaaaatcagaacrcaaa
cactcaatctgtataaatggagaatgggatcctaaagtagactgcaatgaagaagcaaaa
atacaactatgcccacctccacctcaggttcccaatgctygtgatatgacaactacagtg
aattatcaggatggagaaaaaatatcaattctatgtaaagaaaactatttaattcaagat
gcagaagaaattgtgtgcaaggatgggagatggcagtcaatcccacgatgtattgtggta
aagaaacttcttgcaacgcaagagatgcagaagatacgggttcgatccctggatggggaa
gatcccctggggaggagggtgamaacccactccagcrttgttgcctgggaaattccatgg
acagaggaacctgttgggctagagtccactgggtcamaaagagttggacatgactaa

DBGET integrated database retrieval system