KEGG   Bos indicus (zebu cattle): 109570522
Entry
109570522         CDS       T04792                                 

Gene name
CD34
Definition
(RefSeq) hematopoietic progenitor cell antigen CD34 isoform X1
  KO
K06474  CD34 antigen
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109570522 (CD34)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109570522 (CD34)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109570522 (CD34)
CD molecules [BR:biu04090]
 Proteins
  109570522 (CD34)
SSDB
Motif
Pfam: CD34_antigen
Other DBs
NCBI-GeneID: 109570522
NCBI-ProteinID: XP_019832099
Position
16
AA seq 382 aa
MLGRRGARAGRGMVRGWTALCLLSLLPSMEFTQTPMAATTATVSASPEISSPVPTTTFDW
RSMNSSTFRSTSLYDVSQDSNGTTAVTLVPASTDSFTSTSETLPASGAVNSSVQSQTSLA
TTVSSTLISFATSEATLQPSTFPGNISDSLYNSTSPVTSSIITSPSFSPTQSILKSEIKC
SRVKEVKLAHSICLKLNETSSCEEFKKNNEEKLTGFLCQKKQAEVCSLLLAQSEVRPQCL
LLVLTNRTESSSKIKLLEEHRSDLREMGIEDISEEAVSSHQSYSRKTLIALVTSGILLAI
LITTCYFLMNRRSWSPTGERLGEDPYYVENGGGQGYSSGPEASPEAQGKAIVNRGAQENG
TGQATSRNGHSARQRVVADTEL
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgctgggccgcaggggcgcgcgcgcggggcgcgggatggtgcggggctggaccgcgctc
tgcctgctgagtctgctgccttctatggaattcacacagacacccatggcagctactact
gccacagtgtcagccagcccagaaatatcttcacctgtccctacaactacattcgactgg
agaagcatgaactcaagtacttttagaagcaccagcctctacgatgtctctcaggacagc
aatgggaccacagcagtcaccttagttccagcrtctacagacagtttcacgtctacctct
gagaccctcccagcctctggggccgtgaactcttctgtccagtcacagacctctttagcc
accacggtgtcttctaccctcatcagctttgcgacttcagaggcgactctgcagcccagc
acttttcctggaaatatttcggattccctgtacaatagtaccagccctgtgacttcttcc
attattacctctccatcattttctcctacccaaagtatcctcaagagtgaaataaaatgt
tccagagtcaaagaagtgaaattggcccacagcatctgcctgaagctaaatgagacctcc
agctgtgaggagtttaagaagaacaatgaagagaaactgaccggattcctgtgtcagaag
aaacaggccgaggtgtgctccttgctcctggcccagtctgaggtgaggcctcagtgcctg
ctgctggtcctgaccaacaggacagaaagttccagcaagatcaaacttctggaagagcac
cggtctgacctgagagagatgggcatcgaggacatctctgaagaagctgtcagcagccac
cagagctattcccggaagaccttgattgcactggtcacctcggggatcctgctggccatc
ttgatcaccacgtgctatttcctgatgaaccgccgcagctggagcccaacgggagaaagg
ctgggcgaagacccttattacgtggagaacggtggaggccagggctatagctcaggccct
gaggcctcccccgaggctcagggaaaggccattgtgaatcgaggggctcaggagaatggc
accggccaggccacctccagaaacggccattcagcgagacaacgtgtggtggctgatacc
gaactgtga

DBGET integrated database retrieval system