KEGG   Bos indicus (zebu cattle): 109570543
Entry
109570543         CDS       T04792                                 

Gene name
DFFA
Definition
(RefSeq) DNA fragmentation factor subunit alpha
  KO
K02310  DNA fragmentation factor, 45 kD, alpha subunit
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109570543 (DFFA)
SSDB
Motif
Pfam: DFF-C CIDE-N Yuri_gagarin COG2 Muted
Other DBs
NCBI-GeneID: 109570543
NCBI-ProteinID: XP_019832134
Position
16
AA seq 329 aa
MEVPGGPAAPEPGEIRALKQCLLRRNKSREQHGVAASCLKELRNKACDILAIDKSLAPVT
LVLAEDGTIVDDDDYFLCLPANTKFVVLAGNEKWTHNSDGGTAWITQESFDRDETDSGAG
LKWKNVARQLKEDLSSIILLSEEELQMLIDVPCSELAQELSQSHVAVQGLQNTLQQVLDQ
REEARQSRQLLELYLRALEKEGGILSKQQESRADLGDESDAVDTGIRESFSEVTPASQIL
LALKEKPAPELSLSSQDLELVAKEDPKALAVALNWDLKKTEAVQQACNQELRLRLQQVQS
LRSLRSISARTSSLPGDMZNPKRTRRDPM
NT seq 990 nt   +upstreamnt  +downstreamnt
atggaggtccccggcggccctgcagctccggaacccggcgagatccgggctctaaagcag
tgtttgctgcgccgcaacaaaagccgggaacagcacggcgtggcggcctcttgcctcaag
gagctgaggaacaaagcttgtgacattctggccattgataagtccctggcaccagtaacc
ctggtcctggcagaggatggcaccatagtggatgatgatgattacttcctatgtcttcct
gccaatactaagtttgtggtattggctgggaatgagaagtggacacacaattcagatgga
ggtacygcttggattacccaagagtccttcgacagagatgaaacagacagcggggcaggg
ytgaagtggaaraacgtggccaggcagctgaaggaagacctatccagcatcatactgctg
tccgaggaggagctccagatgctcattgatgtcccgtgttcggagctggctcaggaactc
agccaaagtcatgtggcagtccaggggctccagaacaccctccagcaggtgcttgaccag
agagaggaagcccgtcagtccaggcagctcctggaactttaccttcgggctttggagaag
gaaggtggcatcttgtcgaagcagcaagagtccagagctgaccttggggacgagagcgat
gctgttgacacaggcattagagagagcttctccgaagttacgcctgcaagccagatcctc
ttggcgctgaaggagaaacctgccccagagctgagtttgtctagtcaggatctggagttg
gttgccaaggaggaccctaaagcactggctgttgctttgaactgggacctaaagaagacg
gaagccgttcaacaggcctgtaatcaggaacttaggctacgcctccagcaggtgcagagc
ttgcgttctctgaggagcatttcagcaaggacgagttcactgcctggagacatgsagaac
cccaaacgaaccagacgagaccccatgtag

DBGET integrated database retrieval system