KEGG   Bos indicus (zebu cattle): 109570715
Entry
109570715         CDS       T04792                                 

Gene name
SELP
Definition
(RefSeq) P-selectin
  KO
K06496  selectin, platelet
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu05144  Malaria
biu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109570715 (SELP)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    109570715 (SELP)
  09174 Infectious disease: parasitic
   05144 Malaria
    109570715 (SELP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:biu04515]
    109570715 (SELP)
   04090 CD molecules [BR:biu04090]
    109570715 (SELP)
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109570715 (SELP)
   04091 Lectins [BR:biu04091]
    109570715 (SELP)
Cell adhesion molecules [BR:biu04515]
 Selectins
  Selectin family
   109570715 (SELP)
CD molecules [BR:biu04090]
 Proteins
  109570715 (SELP)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Haparin
  Adhesion molecules of cell surface
   109570715 (SELP)
Lectins [BR:biu04091]
 C-Type lectins
  Group 4: Selectins
   109570715 (SELP)
SSDB
Motif
Pfam: Sushi Lectin_C EGF EGF_2 EGF_3
Other DBs
NCBI-GeneID: 109570715
NCBI-ProteinID: XP_019832442
Position
16
AA seq 646 aa
MASCPKAIWNWRFQRAVFRTVQLLCFSVLIFEVINQKEVSAWTYHYSNKTYSWNYSRAFC
QKYYTDLVAIQNKNEIAYLNETIPYYNSYYWIGIRKINNKWTWVGTNKTLTEEAENWADN
EPNNKRNNQDCVEIYIKSLSAPGKWNDEPCWKRKRALCYRASCQDMSCSKQGECIETIGN
YTCSCYPGFYGPECEYVRECGEFDLPQHVHMNCSHPLGNFSFNSHCSFHCAEGYALNGPS
ELECLASGIWTNSPPQCVAVQCPALKSPEQGSMSCVQSAEAFQHQSSCSFSCEEGFELVG
PEVVHCTALGVWTAPTPVCKALQCQDLPTSTKAQVNCSHPFGDFRYQSTCSFTCDEGSFL
VGASVLQCLDTGNWDAPFPECQAVTCAALPNPQNGEKTCVQPLGGSXYESTCWFTCHEGF
SLSGPERLDCTPSGHWTGSPPTCEEVDTVSAPAPGVQCPTLIAPKQGTMSCQHHVRNFGL
NTTCHFGCKAGFTLLGDSALQCRPSRQWTAAAPTCRAVKCAKLPVTEPIVMNCSNPWGNF
SYGSTCSFHCPEGQLLNGSERTVCQENGQWSTTMPTCQAGPLTIQETLTYVGGAAAGTTG
LVTGSILLALLRRRCRQKDDGKSPLNPQSHLGTYGVFTNAAFDPSP
NT seq 1941 nt   +upstreamnt  +downstreamnt
atggccagctgcccaaaagccatctggaactggagatttcagagagcggtcttcagaact
gtccaactcctttgcttcagtgtcctgatcttcgaggtaataaaccagaaagaagtatca
gcatggacctaccactacagcaataaaacatattcatggaattattcccgggcattctgt
cagaagtactacacggatttagtggccatccagaataaaaacgagattgcttatctcaac
gagaccataccttactacaactcttactactggattggtattcgaaagatcaacaataaa
tggacctgggtgggaaccaacaagactctcactgaggaggctgagaactgggctgacaat
gagcctaacaacaagaggaacaaccaggactgtgtggagatctacatcaagagtctgtca
gcccctggcaagtggaatgatgagccctgctggaaaagaaagcgagcactctgctataga
gcctcctgccaggacatgtcctgcagcaagcaaggagagtgcattgagaccattgggaac
tacacctgctcctgttaccctggattctatggaccggagtgtgaatatgtcagagagtgc
ggcgagtttgatcttcctcaacatgtgcacatgaactgcagccaccctcttggaaacttc
tctttcaactcacactgcagcttccactgtgctgaaggctatgcgctgaacggacccagt
gagctggagtgtttggcttctggaatctggacgaattcacccccacagtgtgtagctgtc
cagtgcccggctctgaagtctccggagcaaggaagcatgagctgtgtccagtccgcggaa
gcattccagcaccagtccagctgcagcttcagctgcgaagagggattcgaattagttggg
ccagaggtagtgcactgcacagccttgggggtgtggacagccccaactccggtgtgtaaa
gcattgcagtgccaggatcttccaacctcaactaaggcccaggtgaactgctcgcatccc
tttggcgactttaggtaccagtcgacctgtagcttcacctgcgatgaaggttcattcctg
gtgggagcaagtgtgctgcaatgcctggatacggggaactgggatgctccttttccagaa
tgccaagctgttacctgcgcagctctgccaaaccctcagaatggagaaaagacttgtgtc
caacctcttggaggttccrgttatgagtccacatgctggttcacatgtcatgagggattc
tctttatccggaccagaaagactggactgtactccatctggacactggacgggctcccca
ccaacgtgtgaagaagtggacacagtatcagctcctgctccaggggtgcaatgcccaacc
ctcatcgctccgaagcagggaacaatgtcctgtcagcatcatgtgaggaactttggtttg
aataccacttgccactttggatgcaaagctggattcacactcctgggagatagtgctctc
cagtgcagaccttccagacaatggacggcagcagctcccacgtgcagagctgtcaaatgc
gccaagctacctgttactgagccaatagtgatgaactgctccaacccttggggaaatttc
agctatggatcaacctgcagcttccattgcccagagggtcaattacttaatggctcagaa
agaacagtatgccaagagaatggtcagtggtcaacgaccatgccaacctgtcaagcaggg
ccactgactatccaggaaaccctgacttatgttggtggagcagcagctggtacaacaggc
ttagtgacgggttcaattctcctggctctgctaagaaggcgttgcagacaaaaagatgat
ggaaaaagccccttgaaccctcaaagccacctaggaacatacggagtttttacaaatgct
gcgtttgacccaagcccttaa

DBGET integrated database retrieval system