KEGG   Bos indicus (zebu cattle): 109570717
Entry
109570717         CDS       T04792                                 

Gene name
SELL
Definition
(RefSeq) L-selectin
  KO
K06495  selectin, lymphocyte
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109570717 (SELL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:biu04515]
    109570717 (SELL)
   04090 CD molecules [BR:biu04090]
    109570717 (SELL)
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109570717 (SELL)
   04091 Lectins [BR:biu04091]
    109570717 (SELL)
Cell adhesion molecules [BR:biu04515]
 Selectins
  Selectin family
   109570717 (SELL)
CD molecules [BR:biu04090]
 Proteins
  109570717 (SELL)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Haparin
  Adhesion molecules of cell surface
   109570717 (SELL)
Lectins [BR:biu04091]
 C-Type lectins
  Group 4: Selectins
   109570717 (SELL)
SSDB
Motif
Pfam: Lectin_C Sushi EGF hEGF EGF_2 Plasmod_Pvs28
Other DBs
NCBI-GeneID: 109570717
NCBI-ProteinID: XP_019832443
Position
16
AA seq 373 aa
MLCPWKCQNAQRGLWNVFKLWVWIMLCCDFFAHRGTDCWTYHYSKRPMPWEKARAFCREN
YTDLVAIQNKGEIEYLNKTLPFSRTYYWIGIRKVEGVWTWVGTNKSLTEEAKNWGAGEPN
NRKSKEDCVEIYIKRNKDSGKWNDDACHKAKTALCYTASCKPWSCSGHGQCVEVINNYTC
NCDLGYYGPECQFVTQCVPLEAPKLGTMACTHPLGNFSFMSQCAFNCSKGTDMIGVEETT
CAPFGNWSSPEPTCRVIQCEPLTEPDLGTMDCNHPLVDFGFSSTCTFSCSEEAELTGEKK
TICGLSGNWSSPSPRCQKINRTISINEESDYNPLFIPVAVMVTAFSGLAFIIWLARRLKR
KSKKSRRSMVDAY
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgctatgtccatggaaatgtcaaaatgctcagaggggcttatggaatgtctttaaactg
tgggtctggattatgctctgttgtgatttctttgctcatcgtggcaccgattgctggact
taccattattctaaaagacccatgccctgggaaaaggctagagcgttctgcagggaaaat
tacacagatttagttgccatacaaaacaaaggagagatcgaatacctgaataagacactt
cccttcagccgtacttactactggattggaatccggaaagtagaaggggtgtggacttgg
gtgggaaccaacaaatctctcactgaagaagcaaagaactggggtgcaggggagcccaac
aacaggaagagtaaggaggactgtgtggaaatctatatcaagaggaacaaagactcgggg
aaatggaatgatgatgcctgccacaaagcaaagacagccctctgctacacagcttcttgt
aaaccctggtcatgcagcggccatggacaatgtgtggaagtcatcaataattacacctgc
aactgtgatttggggtactacgggcccgagtgtcagttcgtgactcaatgtgtgcctttg
gaggccccaaagctgggtaccatggcctgcactcaccctttggggaacttcagcttcatg
tcgcagtgtgccttcaactgctccaagggaacagacatgattggggttgaagaaaccact
tgtgcaccatttggaaattggtcatctccagaaccaacctgtcgagtgattcaatgtgag
cctctaacagaacccgatttgggaaccatggactgtaatcacccccttgtcgactttggc
ttttcctccacatgcaccttcagttgttcagaagaagctgagttaactggggagaaaaaa
actatctgtggattgtctggaaattggtccagccctagtccaagatgtcaaaaaataaac
aggactatctcaataaatgaagagagtgattataaccccctcttcatcccggtggcagtt
atggttactgcattctctgggttggcatttatcatttggctggcaaggagattaaaaaga
aaaagcaaaaagtctcggagaagcatggttgatgcatattaa

DBGET integrated database retrieval system