KEGG   Bos indicus (zebu cattle): 109570785Help
Entry
109570785         CDS       T04792                                 

Gene name
FASLG
Definition
(RefSeq) tumor necrosis factor ligand superfamily member 6
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01524  Platinum drug resistance
biu04010  MAPK signaling pathway
biu04014  Ras signaling pathway
biu04060  Cytokine-cytokine receptor interaction
biu04068  FoxO signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04210  Apoptosis
biu04217  Necroptosis
biu04650  Natural killer cell mediated cytotoxicity
biu04722  Neurotrophin signaling pathway
biu04932  Non-alcoholic fatty liver disease (NAFLD)
biu04940  Type I diabetes mellitus
biu05142  Chagas disease (American trypanosomiasis)
biu05143  African trypanosomiasis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05168  Herpes simplex virus 1 infection
biu05170  Human immunodeficiency virus 1 infection
biu05200  Pathways in cancer
biu05205  Proteoglycans in cancer
biu05320  Autoimmune thyroid disease
biu05330  Allograft rejection
biu05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    109570785 (FASLG)
   04010 MAPK signaling pathway
    109570785 (FASLG)
   04068 FoxO signaling pathway
    109570785 (FASLG)
   04151 PI3K-Akt signaling pathway
    109570785 (FASLG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109570785 (FASLG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109570785 (FASLG)
   04217 Necroptosis
    109570785 (FASLG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109570785 (FASLG)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    109570785 (FASLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109570785 (FASLG)
   05205 Proteoglycans in cancer
    109570785 (FASLG)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    109570785 (FASLG)
   05330 Allograft rejection
    109570785 (FASLG)
   05332 Graft-versus-host disease
    109570785 (FASLG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109570785 (FASLG)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    109570785 (FASLG)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109570785 (FASLG)
   05162 Measles
    109570785 (FASLG)
   05164 Influenza A
    109570785 (FASLG)
   05161 Hepatitis B
    109570785 (FASLG)
   05160 Hepatitis C
    109570785 (FASLG)
   05168 Herpes simplex virus 1 infection
    109570785 (FASLG)
   05163 Human cytomegalovirus infection
    109570785 (FASLG)
   05165 Human papillomavirus infection
    109570785 (FASLG)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    109570785 (FASLG)
   05143 African trypanosomiasis
    109570785 (FASLG)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    109570785 (FASLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109570785 (FASLG)
   04052 Cytokines and growth factors [BR:biu04052]
    109570785 (FASLG)
   04090 CD molecules [BR:biu04090]
    109570785 (FASLG)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   109570785 (FASLG)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Tumor necrosis fators
   109570785 (FASLG)
CD molecules [BR:biu04090]
 Proteins
  109570785 (FASLG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF
Motif
Other DBs
NCBI-GeneID: 109570785
NCBI-ProteinID: XP_019832524
Position
16
AA seq 277 aa AA seqDB search
MQQPLNYPYPPIFWVDSSASSPWASPGSVFPCPSSVPGRPGQRRPPPPPPPTLPPPPPLP
PLPPPPLKKRRDHNTGLCLLVMFFMVLVALVGLGLGIFQLFHLQKELAELRESTSQRHTA
SSLEKQIGHPSPPSEKKELKKAAHLTGKLNSRSIPLEWEDTYGIALVSGVKYKKGSLVIN
ETGLYFVYSKVYFRGQSCNNQPLSHKVYSRNFRYPQDMVLMEGKMMNYCTSGKMWARSSY
LGAVFNLTSADHLYVNVSELSLVSFEESKTFFGLYKL
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagcccttgaattacccataccccccaatcttctgggtggacagcagtgccagc
tccccctgggcctctccaggatcagtcttcccctgtccgtcctcagtgccaggaaggccg
gggcaaaggaggccaccaccaccgccacccccaacactaccgccaccgccacccctgcct
ccactaccgccaccacctctgaagaagaggagggaccacaacacaggcctgtgtctcctt
gtgatgtttttcatggttctggtggccctggttggattggggctggggatatttcagctc
ttccatctacagaaggagttggctgaactcagagagtccaccagccaaaggcatacagca
tcatctttggagaagcaaataggtcaccccagtccaccctctgagaaaaaggaactgaaa
aaagcagctcatttaacaggcaagctcaactcaagatccatccctttggaatgggaagac
acctatggaattgccctggtctctggggtgaagtacaagaagggcagccttgtgatcaat
gaaactgggctgtattttgtgtattccaaagtgtacttccggggtcagtcctgcaacaac
cagcccctgagccacaaggtctactccaggaactttaggtacccccaggacatggtgctg
atggaggggaagatgatgaactactgcacttctggcaagatgtgggcccgcagcagctac
ctgggggctgtattcaatctaaccagtgctgaccatttatatgtcaatgtatctgaactc
tctctggtcagttttgaggaatctaagacattttttggcttatataaactctaa

DBGET integrated database retrieval system