KEGG   Bos indicus (zebu cattle): 109570808
Entry
109570808         CDS       T04792                                 

Gene name
IL10
Definition
(RefSeq) interleukin-10
  KO
K05443  interleukin 10
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04061  Viral protein interaction with cytokine and cytokine receptor
biu04068  FoxO signaling pathway
biu04625  C-type lectin receptor signaling pathway
biu04630  JAK-STAT signaling pathway
biu04660  T cell receptor signaling pathway
biu04672  Intestinal immune network for IgA production
biu05133  Pertussis
biu05135  Yersinia infection
biu05140  Leishmaniasis
biu05142  Chagas disease
biu05143  African trypanosomiasis
biu05144  Malaria
biu05145  Toxoplasmosis
biu05146  Amoebiasis
biu05150  Staphylococcus aureus infection
biu05152  Tuberculosis
biu05310  Asthma
biu05320  Autoimmune thyroid disease
biu05321  Inflammatory bowel disease
biu05322  Systemic lupus erythematosus
biu05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109570808 (IL10)
   04068 FoxO signaling pathway
    109570808 (IL10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109570808 (IL10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    109570808 (IL10)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109570808 (IL10)
   04660 T cell receptor signaling pathway
    109570808 (IL10)
   04672 Intestinal immune network for IgA production
    109570808 (IL10)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    109570808 (IL10)
   05322 Systemic lupus erythematosus
    109570808 (IL10)
   05320 Autoimmune thyroid disease
    109570808 (IL10)
   05321 Inflammatory bowel disease
    109570808 (IL10)
   05330 Allograft rejection
    109570808 (IL10)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    109570808 (IL10)
   05133 Pertussis
    109570808 (IL10)
   05150 Staphylococcus aureus infection
    109570808 (IL10)
   05152 Tuberculosis
    109570808 (IL10)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109570808 (IL10)
   05144 Malaria
    109570808 (IL10)
   05145 Toxoplasmosis
    109570808 (IL10)
   05140 Leishmaniasis
    109570808 (IL10)
   05142 Chagas disease
    109570808 (IL10)
   05143 African trypanosomiasis
    109570808 (IL10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109570808 (IL10)
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109570808 (IL10)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interleukins
   109570808 (IL10)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Haparin
  Cytokines
   109570808 (IL10)
SSDB
Motif
Pfam: IL10 IL22
Other DBs
NCBI-GeneID: 109570808
NCBI-ProteinID: XP_019832543
Position
16
AA seq 179 aa
MPSSSALLCCLVFLAGVAASRDASTLSDSSCIHLPTSLPHMLRELRAAFGXVKTFFQMKD
QLHSLLLTQSLLDDFKGYLGCQALSEMIQFYLEEVMPXAENHGPDIKEHVNSLGEKLKTL
RLRLRRCHRFLPCENKSKAVEKVKRVFSELQERGVYKAMSEFDIFINYIETYMTTKMQK
NT seq 540 nt   +upstreamnt  +downstreamnt
atgcccagcagctcagccctgctctgttgcctggtcttcctggctggggtggcagccagy
cgagatgcgagcaccctgtctgacagcagctgtatccacttgccaaccagcctgccccac
atgctgcgggagctccgagctgccttcggcarggtgaagactttctttcaaatgaaggac
caactgcacagcttactgttgacccagtctctgctggatgactttaagggttacctgggt
tgccaagccttgtcggaaatgatccagttttacctggaagaggtgatgccamaggctgag
aaccacgggcctgacatcaaggagcacgtgaactcactgggggagaagctgaagaccctc
cggctgcggctgcggcgctgtcatcgctttctgccctgcgaaaacaagagcaaggcggtg
gagaaggtgaagagagtcttcagtgagctccaagagaggggtgtctacaaagccatgagt
gagtttgacatcttcatcaactacatagaaacctacatgacaacgaagatgcaaaagtga

DBGET integrated database retrieval system