KEGG   Bos indicus (zebu cattle): 109570986Help
Entry
109570986         CDS       T04792                                 

Gene name
SEPT5
Definition
(RefSeq) septin-5
  KO
K04557  septin 5
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu05012  Parkinson disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    109570986 (SEPT5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:biu04131]
    109570986 (SEPT5)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:biu04812]
    109570986 (SEPT5)
Membrane trafficking [BR:biu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    109570986 (SEPT5)
Cytoskeleton proteins [BR:biu04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     109570986 (SEPT5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin MMR_HSR1 RsgA_GTPase GTP_EFTU Ras Roc AAA_16 ABC_tran AAA_29 AAA_22 AIG1 NACHT AAA_7
Motif
Other DBs
NCBI-GeneID: 109570986
NCBI-ProteinID: XP_019832675
Position
17
AA seq 296 aa AA seqDB search
MGQGRRPPSLNSDSFQPPSAAWVREGSQSRGPCWXQGPGLLQEQERAPDLPHPRQDVDKQ
YVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVHSLFLTDLYKERKLLSAEERIS
QTVEILKHTVDIEEKGVKLKLTIVDTPGFGDAVNNSECWKPITDYVDQQFEQYFRDESGL
NRKNIQDNRVHCCLYFISPFGHGLRPVDVGFMKALHEKVNIVPLIAKADCLVPGEIRKLK
ERIREEIDKFGIHVYQFPECDSDEDEDFKQQDRELKVSLQRLGDPRGHATAGLEER
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgggccaggggcggaggcccccttccctgaactctgactccttccagcccccatctgca
gcctgggtcagggaaggaagccagtcccgcgggccctgctggnnncaggggccggggctg
ctccaggaacaggagcgtgcccctgacctgccccacccccgccaggacgtcgacaagcag
tacgtgggcttcgccacgctgcccaaccaggtgcaccgcaagtctgtgaagaagggcttc
gacttcacgctcatggtggccggggagtcaggcctggggaagtccacactggtccacagc
ctcttcctgaccgacctctacaaggagcggaaactgctgagtgccgaggaacgcatcagc
cagacggttgagatcctaaagcatacggtggacattgaagagaagggggtgaagctgaag
ctcaccatcgtggacacaccgggcttcggggacgccgtcaacaactctgagtgctggaag
cccatcaccgactatgtggaccagcagttcgagcagtacttccgggacgagagcggcctc
aaccgcaagaacatccaggacaaccgggtgcactgctgcttgtacttcatctcccctttc
gggcacgggctgcggccggtggacgtgggcttcatgaaggccctgcacgagaaggtgaac
atcgtgcccctcatcgccaaggccgactgtctcgtcccaggggagatccggaagctgaaa
gagcggatccgggaagagatcgacaagtttgggatccacgtgtaccagtttcctgagtgc
gactcggacgaggatgaagacttcaagcagcaggaccgggaactgaaggtgagcctgcag
cgcttgggggaccccagaggccacgctacagcgggtctagaggagcgctag

DBGET integrated database retrieval system