KEGG   Bos indicus (zebu cattle): 109571028
Entry
109571028         CDS       T04792                                 

Gene name
IL2
Definition
(RefSeq) interleukin-2
  KO
K05429  interleukin 2
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04061  Viral protein interaction with cytokine and cytokine receptor
biu04151  PI3K-Akt signaling pathway
biu04625  C-type lectin receptor signaling pathway
biu04630  JAK-STAT signaling pathway
biu04658  Th1 and Th2 cell differentiation
biu04659  Th17 cell differentiation
biu04660  T cell receptor signaling pathway
biu04672  Intestinal immune network for IgA production
biu04940  Type I diabetes mellitus
biu05135  Yersinia infection
biu05142  Chagas disease
biu05162  Measles
biu05166  Human T-cell leukemia virus 1 infection
biu05200  Pathways in cancer
biu05320  Autoimmune thyroid disease
biu05321  Inflammatory bowel disease
biu05330  Allograft rejection
biu05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109571028 (IL2)
   04151 PI3K-Akt signaling pathway
    109571028 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109571028 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    109571028 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109571028 (IL2)
   04660 T cell receptor signaling pathway
    109571028 (IL2)
   04658 Th1 and Th2 cell differentiation
    109571028 (IL2)
   04659 Th17 cell differentiation
    109571028 (IL2)
   04672 Intestinal immune network for IgA production
    109571028 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109571028 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    109571028 (IL2)
   05321 Inflammatory bowel disease
    109571028 (IL2)
   05330 Allograft rejection
    109571028 (IL2)
   05332 Graft-versus-host disease
    109571028 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109571028 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    109571028 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109571028 (IL2)
   05162 Measles
    109571028 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    109571028 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109571028 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109571028 (IL2)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interleukins
   109571028 (IL2)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Haparin
  Cytokines
   109571028 (IL2)
SSDB
Motif
Pfam: IL2 DUF922
Other DBs
NCBI-GeneID: 109571028
NCBI-ProteinID: XP_019832709
UniProt: Q8HZ67
Position
17
AA seq 145 aa
MYKIQLLSCIALTLALVANGAPTSSSTGNTMKEVKSLLLDLQLLLEKVKNPENLKLSRMH
TFDFYVPKVNATELKHLKCLLEELKLLEEVLNLAPSKNLNPREIKDSMDNIKRIVLELQG
SETRFTCEYDDATVNAVEFLNKWIT
NT seq 436 nt   +upstreamnt  +downstreamnt
atgtacaagatacaactcttgtcttgcattgcactaactcttgcactcgttgcaaacggt
gcacctacttcaagctctacggggaacacaatgaaagaagtgaagtcattgctgctggat
ttacagttgcttttggagaaagttaaaaatcctgagaacctcaagctctccaggatgcat
acatttgacttttacgtgcccaaggttaacgctacagaattgaaacatcttaagtgttta
ctagaagaactcaaacttctagaggaagtgctaaatttagctccaagcaaaaacctgaac
cccagagagatcaaggattcaatggacaatatyaagagaatcgttttggaactacaggga
tctgaaacaagattcacatgtgaatatgatgatgcaacagtaaacgctgtagaatttctg
aacaaatggattacct

DBGET integrated database retrieval system