KEGG   Bos indicus (zebu cattle): 109571094
Entry
109571094         CDS       T04792                                 

Gene name
FGG
Definition
(RefSeq) fibrinogen gamma chain isoform X1
  KO
K03905  fibrinogen gamma chain
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
biu04611  Platelet activation
biu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109571094 (FGG)
   04611 Platelet activation
    109571094 (FGG)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    109571094 (FGG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109571094 (FGG)
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109571094 (FGG)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109571094 (FGG)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Haparin
  Extracellular matrix molecules
   109571094 (FGG)
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   109571094 (FGG)
SSDB
Motif
Pfam: Fibrinogen_C Fib_alpha CEP209_CC5 GcnA_N
Other DBs
NCBI-GeneID: 109571094
NCBI-ProteinID: XP_019832859
Position
17
AA seq 443 aa
MSWSSHPPSVIFYILSLLSSACLAYVATRDNCCILDERFGSYCPTTCGIADFLNNYQTSV
DKDLRTLEGILYQVENKTSEARELVKAIQISYNPDQPSKPNNIESATKNSKSMMEEIMKY
ETLISTHESTIRFLQEIYNSNSQKIVNLRDKVVQLEANCQEPCQDTVKIHDVTGRDCQDV
ANKGAKESGLYFIKPLKAKQQFLVYCEIDGSGNGWTVFQKRLDGSLDFKKNWIQYKEGFG
HLSPTGNTEFWLGNEKIHLISTQSTIPYVLRIQLEDWNGRTSTADYASFKVTGENDKYRL
TYAYFIGGDAGDAFDGYDFGDDSSDKFFTSHNGMQFSTWDSDNDKYDGNCAEQDGSGWWM
NKCHAGHLNGVYYQGGTYSKTSTPNGYDNGIIWATWKSRWYSMKKTTMKIIPLNRLAIGE
GQQHQLGGAKQVGVEHHVEIEYD
NT seq 1332 nt   +upstreamnt  +downstreamnt
atgagttggtcctcgcaccctccgagtgtaatcttctacattctttcattgctttcttca
gcatgcctggcatatgttgctacccgagacaactgctgcatcttagatgaaagatttggt
agttattgcccaactacctgtggaattgcagatttcctgaataattaccaaaccagtgta
gacaaagatctacgaactttggaaggcatcttatatcaggttgagaacaaaacatcagaa
gccagagagctggtcaaagcaatccaaatcagctataaccctgatcaaccatcaaagcca
aataacatagagagtgctaccaagaattccaagagtatgatggaagaaattatgaaatat
gaaacactgatatcaacacatgaatcaacaattcgatttttgcaagaaatatataactca
aatagtcaaaaaatcgttaacctaagagataaagtggtccagcttgaagcaaactgtcaa
gagccttgtcaagatacagtgaaaatacatgatgtaactgggagagattgccaagatgtt
gccaataagggggccaaagagagtggactttactttatcaaacctctgaaagctaagcag
cagttcttagtctactgtgaaattgatgggtctggaaatggatggactgtgtttcagaag
aggcttgatggcagtctggatttcaagaaaaactggattcaatataaagaagggtttgga
catctgtctcctactggaaacacagaattttggctgggaaatgagaagattcatttgata
agcacacagtctactatcccttatgtattaagaatacagttggaggactggaatggcaga
accagcactgcagattatgcttcattcaaggtgacaggtgaaaatgacaaataccgcctg
acatatgcttacttcattggtggagatgctggagatgcatttgatggctacgattttggc
gatgattctagtgacaagtttttcacatcccataatggcatgcagttcagtacttgggac
agtgacaatgataagtatgatggcaactgtgctgaacaggatggatctggttggtggatg
aacaaatgtcacgctggccacctcaatggagtttattatcaaggtggcacttactcaaaa
acatctactcctaatggttatgataatggcattatttgggccacatggaaatcccggtgg
tattccatgaagaaaaccaccatgaagataatcccacttaacagacttgccatcggagaa
ggacagcagcaccaactggggggagccaaacaggtcggagtagaacatcacgttgaaata
gaatatgactaa

KEGG   Bos indicus (zebu cattle): 109571095
Entry
109571095         CDS       T04792                                 

Gene name
FGA
Definition
(RefSeq) fibrinogen alpha chain
  KO
K03903  fibrinogen alpha chain
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
biu04611  Platelet activation
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109571095 (FGA)
   04611 Platelet activation
    109571095 (FGA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109571095 (FGA)
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109571095 (FGA)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109571095 (FGA)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Haparin
  Extracellular matrix molecules
   109571095 (FGA)
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   109571095 (FGA)
SSDB
Motif
Pfam: Fibrinogen_C Fib_alpha Fibrinogen_aC FAM76 ORF6C
Other DBs
NCBI-GeneID: 109571095
NCBI-ProteinID: XP_019832861
Position
17
AA seq 863 aa
MRTGRGGSLPFFQLGAPLESALSTAEMFSVRDLCLVLSLVGAIKTEDGSDPPSGDFLTEG
GGVRGPRLVERQQSACKETGWPFCSDEDWNTKCPSGCRMKGLIDEVDQDFTSRINKLRDS
LFNYQKNSKDSNTLTKNIVELMRGDFAKANNNDNTFKQISEDLRSRIEILRRKVIEQVQR
INVLQKNVRDQLVDMKRLEVDIDIKIRSCKGSCSRALEHKVDLEDYKNQQKQLEQVIAIN
LLPSRDIQYLPLIKMSTITGPVPREFKSQLQEAPLEWKALLEMQQTKMVLETFGGDGHAR
GDSVSQGTGLAPGSPRKPGTSSIGNVNPGSYGPGSSGTWNPGRPEPGSAGTWNPGRPEPG
SAGTWNPGRPEPGSAGTWNPGRPEPGSAGTWNPGRPEPGSAGTWNTGSSGSSSFRPDSSG
HGNIRPSSPDWGTFREEGSVSSGTKQEFHTGKLVTTKGDKELLIDNEKVTSGHTTTTRRS
CSKVITKTVTNADGRTETTKEVVKSEDGSDCGDADFDWHHTFPSRGNLDDFFHRDKDDFF
TRSSHEFDGRTGLAPEFAALGESGSSSSKTSTHSKQFVSSSTTVNRGGSAIESKHFKMED
EAESLEDLGFKGAHGTQKGHTKARPARXCYDVLQTRPSGAQSGIFSIKLPASSKIFSVYC
DQETGLGGWLLIQQRMDGSLNFNRTWQDYKRGFGSLNDKGEGEFWLGNEYLHLLTLRGSI
LRVELEDWAGKGAYAEYHLRVGSEAEDYALEVSSYKGTAGDALIEGSVEEGTEYTSHTGM
RFSTFDRDADKWEDNCAEVYGGGWWYNNCQAANLNGIYYPGGSYDPRDNSPYEIENGVVW
VPFRGADYSLRAVRMKIRPLVTQ
NT seq 2592 nt   +upstreamnt  +downstreamnt
atgcggactggaagaggaggcagtcttcctttctttcagctgggtgctcctcttgagtca
gccctatccacggcagagatgttttccgtgagggacctctgcctggtcctgagtttggtg
ggtgcaattaagacagaagatggtagtgatcctcccagtggtgactttttaactgaagga
ggaggggtgcgtggcccaagacttgtggaaagacagcaatctgcctgcaaagagacaggc
tggcccttctgctctgatgaagactggaatacaaaatgcccttctggctgcaggatgaaa
gggttgattgatgaagtcgatcargattttacaagcagaataaataaactaagagattca
ctatttaattatcagaagaacagtaaggactctaatacattgaccaagaacatagtggaa
ctaatgagaggggattttgccaaagctaacaacaatgataatacatttaaacaaatatca
gaagatctgagaagcagaattgagatcctgaggcgcaaagtcatagaacaagtacaacgt
atcaacgttctgcagaaaaatgtcagggatcaactggtagatatgaaacgattggaggtg
gacattgatattaagatccgatcttgcaaagggtcatgcagtagagctttagaacataag
gtagatctggaggactataaaaatcagcagaagcaacttgaacaggttattgccataaac
ctacttccctctagagacattcaatacttaccattgataaaaatgagtacaattacaggc
cctgttcccagagagttcaagagccagctccaagaggcccctctagaatggaaggcactg
ctggaaatgcagcagacgaaaatggtgttggaaactttcggtggcgatggacatgccaga
ggagactctgtatctcaaggaacaggattagcaccaggaagtcccagaaagcctggaacc
agtagtattggaaatgtgaaccctgggagctatggacctggaagtagtggcacttggaac
cccggccgccctgagcccggaagtgctggcacctggaaccccggccgccccgagcccgga
agtgctggcacctggaaccccggccgccccgagcccggaagtgctggcacctggaacccc
ggccgccccgagcccggaagtgctggcacctggaaccccggccgccccgagcccggaagt
gctggcacttggaatactggaagctctggatcttcaagttttaggccagatagctcaggt
catgggaacattaggccttccagtccagactggggcacctttagagaggaaggaagtgta
agttcagggacaaagcaagagttccacacaggtaaacttgtcactactaaaggagataaa
gagcttctgattgataatgagaaggtcacctctggtcacacaactaccactcgtcgttca
tgctctaaagtcattacaaagacagttacaaatgccgacggtcgcacagaaacgaccaaa
gaagtggtaaagtctgaagatggttctgactgcggtgacgcggacttcgactggcaccat
acttttccttcgaggggtaacctagatgatttctttcatagagacaaggatgatttcttc
acccgtagttcacacgagtttgatggtaggacaggcttagcacccgaatttgcagcctta
ggggaatcgggctcttccagtagtaaaacttcaactcacagcaaacagtttgtaagcagc
agcacaactgtcaacagaggtggctccgcgattgaaagcaagcactttaaaatggaagat
gaggccgaaagcctagaggatcttggctttaaaggagcacacggcacccagaaaggccat
actaaagctcgtcctgccagagsttgttatgatgtcctccaaacacgtccttcaggtgcc
caaagtggcattttcagtatcaagctaccagcatccagtaaaattttttctgtttattgc
gatcaagagaccggtttgggaggatggcttttgatccagcaaagaatggatggatcactg
aattttaaccgaacctggcaagactacaagagaggtttcggcagcctaaatgacaaggga
gaaggagaattctggctaggcaatgaatacctccacttactaaccctgaggggctccatc
cttagggttgaattagaagactgggctgggaaaggggcttatgcagaatatcatttgagg
gtaggctctgaggcagaggactatgcccttgaggtctcctcttacaagggcacagcaggt
gatgctctgattgagggttctgtggaggaagggacagagtacacttctcacactggtatg
cggttcagcaccttcgacagggatgcagacaagtgggaagacaactgtgctgaagtctac
ggaggaggctggtggtacaacaactgccaggcagccaatctcaatggcatctactatcct
ggtggctcctatgaccccagggacaacagtccctatgagattgagaatggtgtggtctgg
gtccccttcagaggtgcagattattctctcagggctgttcgtatgaaaatccggcccctt
gtgacacaatag

KEGG   Bos indicus (zebu cattle): 109571096
Entry
109571096         CDS       T04792                                 

Gene name
FGB
Definition
(RefSeq) fibrinogen beta chain
  KO
K03904  fibrinogen beta chain
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
biu04611  Platelet activation
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109571096 (FGB)
   04611 Platelet activation
    109571096 (FGB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109571096 (FGB)
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109571096 (FGB)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   109571096 (FGB)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Haparin
  Extracellular matrix molecules
   109571096 (FGB)
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   109571096 (FGB)
SSDB
Motif
Pfam: Fibrinogen_C Fib_alpha SF-assemblin FANCI_S2 DUF4407 DUF1664 DUF3450
Other DBs
NCBI-GeneID: 109571096
NCBI-ProteinID: XP_019832862
Position
17
AA seq 495 aa
MISCNFEKFKTMKHLLLLLFCAFIVQAQFPTDYDEGQDDRPKVGLGARGHRPYDKKKEEA
PSLRPVPPPISGGGYRARPATATVGQKKVERKPPDADGCLHADPDLGVLCPTGCKLQDTL
VRQERPIRKSVEDLRNTVDSVSRTSSSTFQYITLLKSMWKGRQNQVQDNENVVNEYSSHL
EKHQLYIDETVKNNIPTKLRVLRSILENLRSKIQKLESDVSTQMEYCRTPCTVTCNIPVV
SGKECEEIIRNGGETSEMYLIQPEDSSKPYRVYCDMKTEKGGWTVIQNRQDGSVDFGRKW
DPYKQGFGNIATNAEGKKYCGVPGEYWLGNDRISQLTNMGPTKLLIEMEDWKGDKVTALY
EGFTVQNEANKYQLSVSKYKGTAGNALIEGASQLVGENRTMTIHNSMFFSTYDRDNDGWK
TTDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGAYTWDMAKHGTDDGVVWMNWQGSWYS
MKKMSMKIRPYFPEQ
NT seq 1488 nt   +upstreamnt  +downstreamnt
atgatttcttgcaacttcgaaaaatttaaaaccatgaaacatctattactgctacttttc
tgtgcttttatagttcaggcccaatttcctactgactatgacgagggacaagatgacaga
cctaaggtaggtttgggtgcccgcggtcatcggccctatgacaagaagaaggaagaggcc
cccagcctgagacctgtgccccctcccatcagcggaggtggctatcgggctcgtcccgct
acagcaactgtgggccagaagaaagtggagagaaagccccctgacgctgatggctgcctg
cacgcggacccggatctgggtgtgttgtgtcctacaggatgtaagttgcaagatactttg
gtaagacaggagagaccaatccgaaagagtgtagaagatttacgtaatactgtggactct
gtttcccggacctcttcttccacctttcaatatataactctgctaaaaagcatgtggaaa
ggaaggcagaatcaagtacaagataatgaaaatgtagtaaacgagtactcctcacatctg
gaaaagcaccagttatatatagatgagactgtgaagaataatatcccaactaagcttcgt
gtgctccgttcaattctggagaatttgagaagcaaaatacaaaaattagaatcggatgtc
tcaactcagatggaatactgccgcaccccgtgtactgttacttgcaatattcctgtggtg
tctggcaaagaatgtgaggaaatcatcaggaatggaggtgaaacatctgaaatgtacctc
attcagcctgaggattctagcaaaccatatagagtatactgtgatatgaaaacggaaaaa
ggaggatggacagtaattcagaaccgtcaagatggtagtgttgactttggcaggaaatgg
gatccatataaacaaggatttggaaatattgcaaccaatgcagaagggaagaaatactgt
ggtgtaccaggtgagtattggcttggaaatgacagaattagccagcttaccaatatggga
cccacaaagcttttgattgaaatggaggactggaaaggcgataaggtgacggcactctat
gaaggatttactgtacagaatgaggccaacaaatatcaactgtcagtgagcaaatacaaa
ggaacagctggcaatgccctcatagaaggggcttctcaactggtgggagaaaaccggacc
atgaccatccacaacagcatgttcttcagcacatacgacagagacaacgacggctggaaa
actacagatcccagaaagcagtgttctaaagaagatggtggtggatggtggtataaccga
tgccatgcagccaatcccaatggcagatactactggggtggagcgtacacctgggacatg
gcaaagcacggcacagacgatggagtggtgtggatgaactggcagggctcctggtactca
atgaagaagatgtccatgaagatcaggccttacttcccagagcaatag

DBGET integrated database retrieval system