KEGG   Bos indicus (zebu cattle): 109571180Help
Entry
109571180         CDS       T04792                                 

Gene name
ASIC4
Definition
(RefSeq) LOW QUALITY PROTEIN: acid-sensing ion channel 4
  KO
K04831  acid-sensing ion channel 4
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109571180 (ASIC4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:biu04040]
    109571180 (ASIC4)
Ion channels [BR:biu04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   109571180 (ASIC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ASC
Motif
Other DBs
NCBI-GeneID: 109571180
NCBI-ProteinID: XP_019833002
Position
2
AA seq 667 aa AA seqDB search
MLSGAAGAARRRGRAALAPSLTRSLAGTHAGADSCAGADKGSHKETIEERDKRQQRQQRQ
RHHQGCGAAGSGSDSPTSGPHPVPILFSLALSLEEPLLPPPPLQRAPGAAGQGGRGRKAP
AGPSIWGQMPIEIVCKIKFAEEDAKPKEKEAGDEQSLLGAAQGAAAPRDLATFASTSTLH
GLGRACGPGPHGLRRTLWALALLTSLAAFLYQAAGLARGYLTRPHLVVMDPAAPAPAAGF
PAVTLCNINRFRHSALSDADIFHLANLTGLPPKDRDGHRAAGLRYPEPDMVDILNRTGHQ
LADMLKSCNFSGHHCSASNFSVVYTRYGKCYTFNADPQSSLPSRAGGMGSGLEIMLDIQQ
EEYLPIWRETNETSFEAGIRVQIHSQEEPPYIHQLGFGVSPGFQTFVSCQEQRLTYLPQP
WGNCRAESGLREPELQGYSAYSVSACRLRCEKEAVLQRCHCRMVHMPGNETICPPNIYIE
CADHTLDSLGGGSGGPCFCPTPCNLTRYGKEISMVRIPNRGSARYLARKYNRNETYIREN
FLVLDVFFEALTSEAMEQRAAYGLSALLGDLGGQMGLFIGASILTLLEILDYIYEVSWDR
LKRAWRRPKTPLRTSTGGISTLGLQELKEQSPCPSRGRAEGGGASSLLPNHHHPHGPPGS
LFEDFAC
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atgctgagcggagcggctggggctgcacggcggcgtggcagagcagcgctcgctccctcg
ctcactcgctcgctcgcagggacacacgcaggggctgacagctgtgctggtgctgataag
ggaagccacaaggagacgatcgaggagagagacaagcggcagcagaggcagcagaggcag
aggcatcatcagggctgcggagctgctgggagtgggagtgactcccccacctcgggcccc
caccctgtccccatcctcttctcgcttgccctgagtttagaagagccgctgctgccaccg
ccgccactccagagggcaccgggggctgctggccagggagggaggggcaggaaggctccg
gctggtcccagcatctggggacagatgccgatcgagattgtgtgcaaaatcaaatttgca
gaggaggatgcgaaacccaaggagaaggaggcaggggatgagcagagcctcctgggggcc
gctcaaggggcagcagccccccgggacctagccaccttcgccagcaccagcactctgcat
gggctgggccgggcctgtggcccaggcccccatggactgcggagaaccctctgggcactg
gccctcctcacctctctggctgccttcctgtaccaggcggccggcctggcccggggctac
ctgacccggcctcacctggtggtgatggaccccgctgccccagccccggcggccggcttc
cccgccgtcaccctctgcaacatcaaccgcttccggcattcggccctcagcgacgccgac
atcttccacctggccaacctgaccgggctgccccccaaagaccgggacgggcaccgtgct
gccggcctgcgctacccggagcccgacatggtagacatcctcaaccgcaccggccaccag
ctcgccgacatgctcaagagctgcaacttcagcgggcaccactgctctgctagcaacttc
tctgtggtctatactcgctatggaaagtgttataccttcaacgcggatccgcagagctca
ctgcccagccgggcagggggcatgggcagcggcctggagatcatgttggacattcagcag
gaggagtacctgcccatctggagagagacaaatgagacatcgtttgaagcgggcatccga
gtgcagatccacagccaggaggagccaccctacatccaccagctgggctttggcgtgtct
ccaggcttccagaccttcgtgtcctgccaggaacagcggctgacttacctgccccagccc
tggggcaactgccgagcggagagtgggctcagggagcctgagcttcagggctactcagcc
tacagcgtgtctgcctgccggctgcgctgtgaaaaggaggccgtgcttcagcgctgccat
tgccggatggtgcacatgccaggcaatgagaccatctgcccgccaaatatctacatcgag
tgtgccgaccacacactggactccctgggtgggggctccggaggcccgtgtttctgtcct
actccctgcaacctgacccgctacgggaaagagatctccatggtcaggatccccaacagg
ggctcggcccggtacctggcaagaaaatacaatcgcaacgagacctacatacgagagaac
ttcctggttcttgatgtcttttttgaagccctgacctctgaggccatggagcagcgagca
gcctacggcctgtcagccctgctgggagacctcgggggacagatgggactgttcatcggg
gccagcatcctcacattgctggagatcctcgactacatctatgaggtgtcctgggaccga
ctgaagcgggcgtggcgtcgccccaagacccccctccggacctctactgggggcatctcc
actttggggcttcaggagctgaaggagcagagtccctgcccaagccgaggccgtgctgaa
ggcgggggtgccagcagcctgctccccaaccaccaccacccccacggccccccaggaagc
ctctttgaagacttcgcttgctag

DBGET integrated database retrieval system