KEGG   Bos indicus (zebu cattle): 109571215
Entry
109571215         CDS       T04792                                 

Gene name
SERPIND1
Definition
(RefSeq) heparin cofactor 2
  KO
K03912  heparin cofactor II
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109571215 (SERPIND1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109571215 (SERPIND1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109571215 (SERPIND1)
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109571215 (SERPIND1)
Peptidases and inhibitors [BR:biu01002]
 Peptidase inhibitors
  Family I4: serpin family
   109571215 (SERPIND1)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   109571215 (SERPIND1)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Haparin
  Coagulation and fibrinolysis
   109571215 (SERPIND1)
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 109571215
NCBI-ProteinID: XP_019833072
Position
17
AA seq 566 aa
MWSRSCWAVTRHTAGLCADEAGGRCSICDLCTLEDLDCSPAPKVTEERGRPWPIPPLQSH
FAPAAQSSSGMWCPLRPLLLALLLASACRTLGPWGQRDDGGGEPESMEPRWGRLKGSNAS
GPLPPAAFHEENTVTGEWAADGEEEEDYLDLEKIFGEDDNYSDVVDAAPPXXXGAGAGSV
LPLFPGKSRVQRLNLLNAQFAFDLYRALAARVGAADNVFLAPVGVSAAMAMLSLGLAGDT
HQEVHTALRFAEFVNASAAYELGTVHNLFRKLIHRLFRRNFGYTLRSVSDLYVQKQLPVL
DDFKTQVREYYFAEVRAADFSDPAFLAHTNRHVARLTKGLIRDALQDVDPATQMLLLNCL
YFKGSWVNKFPVEMTHNHNFRLNEREVVKVPMMQTKGAFLAASDQELDCDVLRLEYVGGI
SMLVVVPHKLSGMKTLESQLTPQAVERWQRSMTNRTREVLLPKFKLEKDYDLVGALRALG
VTALFDKHSNTTGITGQRIVIDLFKHQGTITVNEEGTQAAAVTAVGFMPLSTQVRFSVDR
PFLFLIYEHRTSCLLFLGRVANPTRP
NT seq 1701 nt   +upstreamnt  +downstreamnt
atgtggagtcgcagctgctgggcggtgaccaggcacacagcggggctttgtgctgacgag
gctggggggcggtgttccatctgcgacctgtgtactttggaagacctcgactgcagccca
gcaccaaaggtcacagaagagcgcggccgaccttggccgattccacccctgcagagccac
ttcgcaccagcggcacagagctcctccgggatgtggtgcccgctgcgcccgctcctgctg
gccctccttctggcatctgcgtgcaggaccctcggcccgtgggggcagcgtgatgatggc
gggggcgagcctgagtccatggagccccggtgggggcggctgaagggcagcaacgcgagt
gggcccctgccgcccgccgccttccacgaggagaacaccgtcaccggcgagtgggccgcg
gacggggaggaggaggaggactacctggacctggagaagatcttcggggaggacgacaac
tacagcgacgtcgtggacgcggccccccccnnnnnnnccggggcgggcgccggcagcgtg
ctcccgctctttcccggcaagagccgcgtgcagcggctcaacctcctcaaygcgcagttc
gccttcgacctgtaccgggcgctagcggcgcgggtcggcgcggccgacaacgtcttcctg
gcacccgtgggcgtgtcggcggccatggccatgctctccctgggcctggcgggcgacacc
caccaggaggtgcacacggccctgcgctttgccgagttcgtcaacgccagcgccgcctay
gagctgggcaccgtccacaacctgttccggaagctgatccaccgcctcttccgcaggaac
ttcgggtacacgctgcgctccgtcagcgacctctatgtgcagaagcagctcccggtcctg
gacgacttcaagacccaggtccgggagtactacttcgccgaggtccgggcggccgacttc
tccgatcccgccttcctcgcccacacgaaccggcacgtggcccggctcaccaagggcctc
atacgagacgcactgcaggaygtggacccygcgacgcagatgctgctcctcaactgcctc
tacttcaaagggtcctgggtgaacaaattcccggtggaaatgacgcacaaccacaacttc
cggctgaacgagcgggaggtggtcaaggtccccatgatgcagaccaagggcgcgttcctg
gcggccagcgaccaggagctggactgcgacgtgctgcggctggagtacgtggggggcatc
agcatgctggtggtggtcccacacaagctgtccgggatgaagaccctggagagccagctg
acaccccaggcggtggagcggtggcagaggagcatgacaaacaggacgcgggaagtgctc
ctgcccaagttcaagctggaaaaggactacgacctrgtgggcgccctgcgggccctgggg
gtcacggcgctcttcgacaagcacagcaacaccacggggatcacgggccagaggatcgtc
attgacctgttcaaacaccagggcaccatcacggtgaacgaggagggcacacaggccgca
gccgtgaccgccgtggggttcatgccgctgtccacccaggtccgcttcagcgtcgaccgg
cccttcctgttcctcatctacgagcaccgcaccagctgcctgctcttcctgggccgggtc
gccaaccccaccaggccttag

DBGET integrated database retrieval system