KEGG   Bos indicus (zebu cattle): 109571379
Entry
109571379         CDS       T04792                                 

Gene name
DIABLO
Definition
(RefSeq) diablo homolog, mitochondrial isoform X1
  KO
K10522  diablo
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04210  Apoptosis
biu04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:biu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109571379 (DIABLO)
   04215 Apoptosis - multiple species
    109571379 (DIABLO)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:biu04121]
    109571379 (DIABLO)
   03029 Mitochondrial biogenesis [BR:biu03029]
    109571379 (DIABLO)
Ubiquitin system [BR:biu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     109571379 (DIABLO)
Mitochondrial biogenesis [BR:biu03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    109571379 (DIABLO)
SSDB
Motif
Pfam: Smac_DIABLO
Other DBs
NCBI-GeneID: 109571379
NCBI-ProteinID: XP_019833365
Position
17
AA seq 238 aa
MAALRSWLSRSVSSLFRYRQCVPVVANFKKRCFSELIRPWHKTVAVGFGVTLCAVPIAQK
PEPHSLSNDTLMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLISLYRQYTSLLG
KMNSQEEDEVWQVIIGARVEMTSKQQEYLKLETTWMTAVSLSEMAAEAAYQTGADQASIT
ARSHIQLVKSQVQEVRQLSQKAETKLAEAQTEELRQKTQEDGSERAEPEEQEAYLRED
NT seq 717 nt   +upstreamnt  +downstreamnt
atggcggctctacggagttggctttctcggagcgtatcctcgcttttcaggtacagacag
tgtgttccagtcgtggctaactttaagaagcgctgtttctcggaattgataagaccatgg
cacaaaacggtggctgtgggatttggggtcactctgtgtgcagttcctattgcccagaaa
ccrgagcctcattctcttagtaacgatacattaatgaggagggctgtgtctttggtaaca
gatagcacctctacctttctctctcagaccacatatgcattgatcgaagcaatcactgaa
tatactaaggctgtttataccttaatttctctgtaccgacaatacacaagtttacttggg
aaaatgaattcacaggaggaagatgaagtgtggcaggtgatcataggagccagagttgag
atgacttcaaaacaacaagagtacctgaagctggaaaccacctggatgactgcagttagt
ctttcagagatggcagcagaagctgcctaccaaacaggcgcggaccaggcctccataacg
gccaggagtcacatccagctggtgaaatcgcaggtgcaggaggtacgccagctttcccag
aaggcggaaaccaagttggcagaagcacagacagaggaactccgacagaaaacccaggag
gacgggagcgagagggccgagccggaggagcaggaggcctacctgcgtgaggattga

DBGET integrated database retrieval system